BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30461 (674 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 21 7.0 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 21 9.2 AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein p... 21 9.2 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 21 9.2 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 21.4 bits (43), Expect = 7.0 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 430 ILGRFKELQFFTGESMDCDGMFAMMELETLMVRKYQFMMFF 552 IL R+KEL ++M + +F + ETL Q + F+ Sbjct: 174 ILMRYKELNRVILDNMSRNHLFLVRRTETLAQILNQTVNFY 214 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 21.0 bits (42), Expect = 9.2 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = -3 Query: 558 MFEKHHELVFAYHQSL*FHHGKHAITI 478 M +HHE V HQ H K+ + + Sbjct: 114 MLLRHHEEVADGHQHHFLHENKYQLEV 140 >AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein protein. Length = 210 Score = 21.0 bits (42), Expect = 9.2 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = -3 Query: 558 MFEKHHELVFAYHQSL*FHHGKHAITI 478 M +HHE V HQ H K+ + + Sbjct: 114 MLLRHHEEVADGHQHHFLHENKYQLEV 140 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 21.0 bits (42), Expect = 9.2 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = -3 Query: 558 MFEKHHELVFAYHQSL*FHHGKHAITI 478 M +HHE V HQ H K+ + + Sbjct: 114 MLLRHHEEVADGHQHHFLHENKYQLEV 140 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,123 Number of Sequences: 336 Number of extensions: 3063 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17593745 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -