BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30459 (790 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1105.10 |rav1||RAVE complex subunit Rav1 |Schizosaccharomyce... 26 5.4 SPAC631.02 |||bromodomain protein|Schizosaccharomyces pombe|chr ... 26 5.4 SPAC26H5.03 |||WD repeat protein Cac2|Schizosaccharomyces pombe|... 25 9.4 >SPBC1105.10 |rav1||RAVE complex subunit Rav1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1297 Score = 26.2 bits (55), Expect = 5.4 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +1 Query: 1 ERERTSIDEPIETKKTKPDPQYLL--SSANIQNMDIDSVLE 117 + +R S +EP+ K DP ++L N+ ID LE Sbjct: 1169 DSQRNSTNEPVRNKFPSDDPAFILLYECLRSSNVQIDESLE 1209 >SPAC631.02 |||bromodomain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 727 Score = 26.2 bits (55), Expect = 5.4 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 353 ASHFSDIVNFVHVNCVIFNG 412 A HF D +N + NC ++NG Sbjct: 293 AQHFIDDMNLMFSNCFLYNG 312 >SPAC26H5.03 |||WD repeat protein Cac2|Schizosaccharomyces pombe|chr 1|||Manual Length = 512 Score = 25.4 bits (53), Expect = 9.4 Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 4/72 (5%) Frame = +1 Query: 7 ERTSIDEPIETKKTKPDP----QYLLSSANIQNMDIDSVLEKLHGP*QIDMLLMWALLIR 174 E + I EPIET P + L S+ANI D LE+ P ++ + ++L Sbjct: 240 ESSGISEPIETSNNNESPVSKHEALSSTANIVK---DGSLERTEPPNSLNSKISYSLYCN 296 Query: 175 SHCVLLYVKESY 210 V + + ++ Sbjct: 297 ETLVSFFRRPAF 308 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,071,202 Number of Sequences: 5004 Number of extensions: 62494 Number of successful extensions: 142 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 142 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 383374054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -