BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30459 (790 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK097364-1|BAC05020.1| 470|Homo sapiens protein ( Homo sapiens ... 30 8.3 >AK097364-1|BAC05020.1| 470|Homo sapiens protein ( Homo sapiens cDNA FLJ40045 fis, clone SYNOV2001111, highly similar to Human (hybridoma H210) anti-hepatitis A IgG variable region, ). Length = 470 Score = 30.3 bits (65), Expect = 8.3 Identities = 23/61 (37%), Positives = 31/61 (50%), Gaps = 3/61 (4%) Frame = -3 Query: 785 LYIDLLFYTKIKTYIYICAVLLKERVLKVLFYHKNYQCLV-ISHHSASSRFCFP--PDNK 615 +Y+DL T T IY CA+LL+ V + LF H LV +S S FP P +K Sbjct: 98 VYMDLDRLTIEDTAIYFCAILLEHEV-RALFDHWGQGTLVTVSSASTKGPSVFPLAPSSK 156 Query: 614 T 612 + Sbjct: 157 S 157 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,231,689 Number of Sequences: 237096 Number of extensions: 2069911 Number of successful extensions: 2620 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2535 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2612 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9646050614 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -