SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= heS30459
         (790 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK097364-1|BAC05020.1|  470|Homo sapiens protein ( Homo sapiens ...    30   8.3  

>AK097364-1|BAC05020.1|  470|Homo sapiens protein ( Homo sapiens
           cDNA FLJ40045 fis, clone SYNOV2001111, highly similar to
           Human (hybridoma H210) anti-hepatitis A IgG variable
           region, ).
          Length = 470

 Score = 30.3 bits (65), Expect = 8.3
 Identities = 23/61 (37%), Positives = 31/61 (50%), Gaps = 3/61 (4%)
 Frame = -3

Query: 785 LYIDLLFYTKIKTYIYICAVLLKERVLKVLFYHKNYQCLV-ISHHSASSRFCFP--PDNK 615
           +Y+DL   T   T IY CA+LL+  V + LF H     LV +S  S      FP  P +K
Sbjct: 98  VYMDLDRLTIEDTAIYFCAILLEHEV-RALFDHWGQGTLVTVSSASTKGPSVFPLAPSSK 156

Query: 614 T 612
           +
Sbjct: 157 S 157


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 103,231,689
Number of Sequences: 237096
Number of extensions: 2069911
Number of successful extensions: 2620
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2535
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2612
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 9646050614
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -