BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30459 (790 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 22 5.7 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 7.5 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 22.2 bits (45), Expect = 5.7 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = -2 Query: 363 KWLAQ*HITLYYLNILINPITVGLNYVFYTYNF 265 +WL LYY + INPI L + Y F Sbjct: 307 EWLYILSGCLYYFSTTINPILYNLMSIKYRNAF 339 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 7.5 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +2 Query: 380 FVHVNCVIFNGKLTIIIRKCYKKTSKGL*SGI 475 F ++ C++ G L + IR Y G SG+ Sbjct: 600 FANLQCIVPTGDLPLNIRWSYPGEEMGGSSGV 631 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,799 Number of Sequences: 438 Number of extensions: 4292 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24882285 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -