BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30454 (501 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) 148 3e-36 SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) 130 5e-31 SB_8490| Best HMM Match : HSP70 (HMM E-Value=0) 114 3e-26 SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) 84 7e-17 SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.014 SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.019 SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.043 SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) 33 0.10 SB_3809| Best HMM Match : DUF1014 (HMM E-Value=8.7e-09) 33 0.13 SB_6714| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.31 SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.40 SB_46132| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.53 SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) 31 0.53 SB_15392| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.71 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 31 0.71 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.71 SB_12462| Best HMM Match : Kinesin (HMM E-Value=0) 31 0.71 SB_25234| Best HMM Match : SMC_hinge (HMM E-Value=3.7e-28) 30 0.93 SB_46225| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00052) 30 0.93 SB_42014| Best HMM Match : Myosin_tail_1 (HMM E-Value=0.083) 30 1.2 SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_57319| Best HMM Match : Pox_A_type_inc (HMM E-Value=6.3e-06) 30 1.2 SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 30 1.2 SB_35674| Best HMM Match : SH2 (HMM E-Value=0) 30 1.2 SB_15994| Best HMM Match : Pox_A_type_inc (HMM E-Value=2e-06) 30 1.2 SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) 29 1.6 SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_6748| Best HMM Match : Pkinase (HMM E-Value=1.7e-05) 29 2.2 SB_59386| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_6077| Best HMM Match : EGF (HMM E-Value=0) 29 2.2 SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) 29 2.8 SB_44787| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_12412| Best HMM Match : Kinesin (HMM E-Value=6.3e-15) 28 3.8 SB_23774| Best HMM Match : Kinesin (HMM E-Value=0) 28 3.8 SB_54892| Best HMM Match : DHH (HMM E-Value=0.057) 28 5.0 SB_40334| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_45987| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_11774| Best HMM Match : M (HMM E-Value=8.5e-09) 28 5.0 SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) 27 6.6 SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_3000| Best HMM Match : Extensin_2 (HMM E-Value=0.058) 27 6.6 SB_54051| Best HMM Match : WSC (HMM E-Value=1.8e-08) 27 6.6 SB_48456| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) 27 6.6 SB_18255| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_3240| Best HMM Match : Sec8_exocyst (HMM E-Value=0.48) 27 6.6 SB_59138| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_58677| Best HMM Match : Pkinase (HMM E-Value=2.8e-33) 27 8.7 SB_32331| Best HMM Match : DivIVA (HMM E-Value=0.86) 27 8.7 SB_26314| Best HMM Match : SURF6 (HMM E-Value=2.8) 27 8.7 SB_23940| Best HMM Match : MuDR (HMM E-Value=0.24) 27 8.7 SB_22651| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) 27 8.7 SB_3878| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_52390| Best HMM Match : Cauli_DNA-bind (HMM E-Value=6.4) 27 8.7 SB_49663| Best HMM Match : TolA (HMM E-Value=0.059) 27 8.7 SB_32504| Best HMM Match : TolA (HMM E-Value=0.52) 27 8.7 SB_8304| Best HMM Match : PLAT (HMM E-Value=0) 27 8.7 >SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1097 Score = 148 bits (358), Expect = 3e-36 Identities = 67/110 (60%), Positives = 87/110 (79%) Frame = +3 Query: 3 ITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKI 182 ITNDKGRLSKE+IERMVNEA KY+ ED+KQ++ IQ KN+LESY +SMKST+ED+K+K+KI Sbjct: 505 ITNDKGRLSKEDIERMVNEASKYKEEDEKQRDRIQTKNSLESYAYSMKSTVEDDKVKDKI 564 Query: 183 SDSDKQTILDKCNEHHQVAGFQPTADKEEYEHKQXXLXGICNPIXXKMYQ 332 S+ DK+ ILDKC E + TA+K+E+E+ Q L +CNPI K+YQ Sbjct: 565 SEEDKKAILDKCTEVLKWLDTNQTAEKDEFEYHQKELEKVCNPIITKLYQ 614 >SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 746 Score = 130 bits (315), Expect = 5e-31 Identities = 59/110 (53%), Positives = 81/110 (73%) Frame = +3 Query: 3 ITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKI 182 ITNDKGRLSKE+IERMV EAEK++ D+ +E IQ+KN+LESY FSMKSTMEDEK+K+K+ Sbjct: 597 ITNDKGRLSKEDIERMVKEAEKFKAADEAVRERIQSKNSLESYAFSMKSTMEDEKVKDKL 656 Query: 183 SDSDKQTILDKCNEHHQVAGFQPTADKEEYEHKQXXLXGICNPIXXKMYQ 332 S+ +++ ++ +C +A+KEE + Q L G+CNPI K+YQ Sbjct: 657 SEDEREKVISRCKATLDWLEHNQSAEKEEIDAHQKELEGVCNPIITKLYQ 706 >SB_8490| Best HMM Match : HSP70 (HMM E-Value=0) Length = 640 Score = 114 bits (275), Expect = 3e-26 Identities = 53/109 (48%), Positives = 76/109 (69%) Frame = +3 Query: 3 ITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKI 182 ITNDKGRLSKEEI+RM+N+AEKY++ED+ Q+E I A+N LESY F +KS + + L+ K+ Sbjct: 504 ITNDKGRLSKEEIDRMINDAEKYKSEDEAQREKIAARNRLESYAFGVKSAISEPSLEGKL 563 Query: 183 SDSDKQTILDKCNEHHQVAGFQPTADKEEYEHKQXXLXGICNPIXXKMY 329 S SDK T+ +K E A+KEE+E ++ L +C+PI K++ Sbjct: 564 SQSDKDTVKNKVEEVLNWLEKNSLAEKEEFEEQEKELQRVCSPIMAKVH 612 >SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1327 Score = 83.8 bits (198), Expect = 7e-17 Identities = 39/71 (54%), Positives = 56/71 (78%), Gaps = 1/71 (1%) Frame = +3 Query: 3 ITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMED-EKLKEK 179 ITND+ RL+ E+IERMVN+AEK+ +ED K KE ++A+N LESY +S+K+ + D EKL K Sbjct: 1198 ITNDQNRLTPEDIERMVNDAEKFADEDKKTKEKVEARNELESYAYSLKNQVGDKEKLGGK 1257 Query: 180 ISDSDKQTILD 212 +S+ DK+TI + Sbjct: 1258 LSEDDKKTITE 1268 >SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 766 Score = 36.3 bits (80), Expect = 0.014 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 2/70 (2%) Frame = +3 Query: 3 ITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESY--CFSMKSTMEDEKLKE 176 + G LSK+ IE M+ EAEKY E DKQK+ + K + + K E +++ Sbjct: 308 VIQSSGGLSKDAIENMIKEAEKYA-EADKQKKVEKLKEEIAKVREVLANKDNETGETIRQ 366 Query: 177 KISDSDKQTI 206 S+ ++++ Sbjct: 367 AYSELQQKSL 376 >SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 35.9 bits (79), Expect = 0.019 Identities = 25/95 (26%), Positives = 48/95 (50%), Gaps = 1/95 (1%) Frame = +3 Query: 3 ITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKI 182 + +K RL EE+ER+ E +K E+ K++ET++ K L+ +E+E+ + + Sbjct: 277 LEEEKKRL--EELERLKEEKDKMLEEELKKRETLEEKQKLQD------KILEEERKRLEN 328 Query: 183 SDSDKQTILDKCNE-HHQVAGFQPTADKEEYEHKQ 284 + ++Q E H ++A + A K E K+ Sbjct: 329 LEKERQAAQQAMQEAHDKLAAAEEAAKKASEEAKK 363 >SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1019 Score = 34.7 bits (76), Expect = 0.043 Identities = 22/51 (43%), Positives = 33/51 (64%), Gaps = 1/51 (1%) Frame = +3 Query: 57 EAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKIS-DSDKQTI 206 EA K R DD + +AKNALES+ F ++ M E L EK+S +++++TI Sbjct: 704 EAPKAR--DDAKAANERAKNALESHIFGVRDEMNSE-LGEKLSTEAERETI 751 >SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) Length = 256 Score = 33.5 bits (73), Expect = 0.10 Identities = 22/86 (25%), Positives = 41/86 (47%), Gaps = 1/86 (1%) Frame = +3 Query: 30 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 209 K E+E+ E EK R E +KQ+ + K LES ++ + + EK + ++ ++ Sbjct: 105 KNEVEKERQEEEKRRMEIEKQRMESEKKRILESKQKRIEESKDTIHDNEKFLEEQRKRLV 164 Query: 210 DKC-NEHHQVAGFQPTADKEEYEHKQ 284 +K NE + KEE + ++ Sbjct: 165 EKVKNEGEEERMLHDQRQKEEEQWRK 190 >SB_3809| Best HMM Match : DUF1014 (HMM E-Value=8.7e-09) Length = 265 Score = 33.1 bits (72), Expect = 0.13 Identities = 21/89 (23%), Positives = 44/89 (49%), Gaps = 1/89 (1%) Frame = +3 Query: 12 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 191 +K R +EE +++ + +K+ ++ K+ E ++ KNA E++ LK K S+S Sbjct: 50 EKERKEREEEDKLWEDDDKHEQQEKKRLEALERKNAARQML-----EEEEKSLKGKTSNS 104 Query: 192 DKQTILDKCNEHH-QVAGFQPTADKEEYE 275 + + EH ++A Q K++ + Sbjct: 105 SAKMTRAQITEHQAKLAAEQEKLQKQKQQ 133 >SB_6714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 31.9 bits (69), Expect = 0.31 Identities = 22/91 (24%), Positives = 45/91 (49%), Gaps = 1/91 (1%) Frame = +3 Query: 12 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKL-KEKISD 188 D+ + KE+ E M E ++ ++++ KE + + ++ K M+ E++ KE + Sbjct: 60 DQEEMDKEDKEEMDKEDKEEMDQEEMDKEEMDQEE-MDKEDKEDKEEMDQEEMDKEDKEE 118 Query: 189 SDKQTILDKCNEHHQVAGFQPTADKEEYEHK 281 DK+ +DK ++ G DKEE + + Sbjct: 119 MDKEE-MDKEDKEEMGKGEMDKEDKEEMDQE 148 Score = 28.7 bits (61), Expect = 2.8 Identities = 21/91 (23%), Positives = 44/91 (48%) Frame = +3 Query: 12 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 191 DK ++ KE+ E M + + N++DK++ + K ++ M ++E KE + Sbjct: 25 DKEKMDKEDKEEM--DKQDKENKEDKEEMDKEDKEEMDQE--EMDKEDKEEMDKEDKEEM 80 Query: 192 DKQTILDKCNEHHQVAGFQPTADKEEYEHKQ 284 D++ +DK + + DKEE + ++ Sbjct: 81 DQEE-MDKEEMDQEEMDKEDKEDKEEMDQEE 110 Score = 28.7 bits (61), Expect = 2.8 Identities = 24/96 (25%), Positives = 47/96 (48%), Gaps = 5/96 (5%) Frame = +3 Query: 12 DKGRLSKEEIERMVNEAEKYRNEDDKQ-KETIQAKNALESYCFSMKSTME----DEKLKE 176 DK + KEE+++ E E + E DK+ KE + + E M M+ +E +E Sbjct: 115 DKEEMDKEEMDKEDKE-EMGKGEMDKEDKEEMDQEMDKEEMDQEMDKEMDKEDKEEMDQE 173 Query: 177 KISDSDKQTILDKCNEHHQVAGFQPTADKEEYEHKQ 284 ++ DK+ + + ++ + Q DK++ E+K+ Sbjct: 174 EMDKQDKEEMDQEMDKQDKEEMDQEEMDKQDKENKE 209 >SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.5 bits (68), Expect = 0.40 Identities = 20/90 (22%), Positives = 46/90 (51%) Frame = +3 Query: 15 KGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSD 194 K + K++ ++ N+ K +K+K+ ++ K E+ + T+E E +EKI +++ Sbjct: 26 KKKKKKKKKKKKKNKKNKKNKNKNKKKKKMKKKKEEEAEVG--EKTLEAENEEEKIEETE 83 Query: 195 KQTILDKCNEHHQVAGFQPTADKEEYEHKQ 284 K+ ++ E + G + ++EE E + Sbjct: 84 KEKDEEEKIEEEEKEGGEEENEEEEEEETE 113 Score = 29.9 bits (64), Expect = 1.2 Identities = 19/89 (21%), Positives = 45/89 (50%) Frame = +3 Query: 9 NDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISD 188 N K + +K + ++ +K E + ++T++A+N E ++ T +++ +EKI + Sbjct: 39 NKKNKKNKNKNKKKKKMKKKKEEEAEVGEKTLEAENEEEK----IEETEKEKDEEEKIEE 94 Query: 189 SDKQTILDKCNEHHQVAGFQPTADKEEYE 275 +K+ ++ E + + +EEYE Sbjct: 95 EEKEGGEEENEEEEEEETEEEEEKEEEYE 123 >SB_46132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 31.1 bits (67), Expect = 0.53 Identities = 27/96 (28%), Positives = 43/96 (44%), Gaps = 3/96 (3%) Frame = +3 Query: 6 TNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKIS 185 ++D+ S ++ R +E KY N D + ET + + E T + E LK++ Sbjct: 878 SDDEVETSDRQLRRK-SEKPKY-NSPDSEGETSYSSSDGEF------ETSDRELLKKREK 929 Query: 186 DSDKQTILDKCNEHHQ---VAGFQPTADKEEYEHKQ 284 DS LD+ N+H Q + D EE H+Q Sbjct: 930 DSSSDDELDRANKHQQKKRKKSNHKSPDSEETSHRQ 965 >SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) Length = 317 Score = 31.1 bits (67), Expect = 0.53 Identities = 17/62 (27%), Positives = 32/62 (51%) Frame = +3 Query: 30 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 209 K E+E+ E EK R E +KQ+ + K LES ++ + + EK + ++ ++ Sbjct: 223 KNEVEKERQEEEKRRMEIEKQRMESEKKRILESKQKRIEESKDTIHDNEKFLEEQRKRLV 282 Query: 210 DK 215 +K Sbjct: 283 EK 284 >SB_15392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 30.7 bits (66), Expect = 0.71 Identities = 15/85 (17%), Positives = 44/85 (51%) Frame = +3 Query: 30 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 209 K+E++ + E+ + ++QK+ +Q + E K +++E+ K+++ + KQ + Sbjct: 88 KQEVQEEQKQEEQEEQKQEEQKQEVQEEQKQEEQ-EEQKQEVQEEQ-KQEVQEEQKQEVQ 145 Query: 210 DKCNEHHQVAGFQPTADKEEYEHKQ 284 ++ + Q Q ++++ E ++ Sbjct: 146 EEQKQEVQEEQKQEEQEEQKQEEQE 170 Score = 27.9 bits (59), Expect = 5.0 Identities = 16/82 (19%), Positives = 42/82 (51%) Frame = +3 Query: 30 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 209 K+E ++ + E+ + E ++QK+ +Q + E K +++E+ K+++ + KQ Sbjct: 104 KQEEQKQEVQEEQKQEEQEEQKQEVQEEQKQEVQ-EEQKQEVQEEQ-KQEVQEEQKQEEQ 161 Query: 210 DKCNEHHQVAGFQPTADKEEYE 275 ++ + Q Q ++++ E Sbjct: 162 EEQKQEEQEEQKQEVQEEQKQE 183 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 30.7 bits (66), Expect = 0.71 Identities = 21/91 (23%), Positives = 46/91 (50%) Frame = +3 Query: 12 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 191 ++ + KEE ER+ EAE+ R ED++Q+ + + A + + E ++LK++ + Sbjct: 411 EEEKRQKEEEERLRVEAERQREEDERQRAEDERQRAEDE---RQRVKHEMQRLKDERRRA 467 Query: 192 DKQTILDKCNEHHQVAGFQPTADKEEYEHKQ 284 ++ I + ++ Q +KE +K+ Sbjct: 468 EEDEI---ARQEEELRRLQEQREKELKRYKE 495 Score = 27.1 bits (57), Expect = 8.7 Identities = 17/69 (24%), Positives = 38/69 (55%), Gaps = 4/69 (5%) Frame = +3 Query: 6 TNDKGRLSKEE---IERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLK- 173 T ++ R ++EE I R EAE+ R E +++++ + +ALE C + + ++K Sbjct: 508 TEERERQAREEEDRIRREREEAERLRREKEQREQLVPHSDALE--CAIKPLNLLEARIKA 565 Query: 174 EKISDSDKQ 200 +K+ + ++ Sbjct: 566 QKLEEEQRE 574 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 30.7 bits (66), Expect = 0.71 Identities = 24/87 (27%), Positives = 37/87 (42%) Frame = +3 Query: 15 KGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSD 194 K EIE M EK R +++ ++ + + L + S +E+ +E +SDSD Sbjct: 1939 KNEEKNNEIEEM---REKMRKANEEIEKILSKNSKLSDILNELNSGIENILNEETLSDSD 1995 Query: 195 KQTILDKCNEHHQVAGFQPTADKEEYE 275 L K E + Q KEE E Sbjct: 1996 PNVKLQKLREKFENLEKQVNNVKEEAE 2022 Score = 27.5 bits (58), Expect = 6.6 Identities = 24/86 (27%), Positives = 40/86 (46%), Gaps = 4/86 (4%) Frame = +3 Query: 30 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDE--KLKEKISDSDK-- 197 KEE E +V + + RN+ K+ E ++++ L K M+DE KL+ +I K Sbjct: 2543 KEEAEGLVEKLKVQRNQMIKEIEELKSEKGL----LEQKQQMQDEAQKLRNEIEVLKKLH 2598 Query: 198 QTILDKCNEHHQVAGFQPTADKEEYE 275 L+ N+ + + KE YE Sbjct: 2599 AIALEDANQKSEKELRREKMKKERYE 2624 >SB_12462| Best HMM Match : Kinesin (HMM E-Value=0) Length = 803 Score = 30.7 bits (66), Expect = 0.71 Identities = 18/73 (24%), Positives = 36/73 (49%) Frame = +3 Query: 12 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 191 D+ + + I+R+ N + Y+ E D +E + E Y S++ + KL+++I D Sbjct: 560 DEIKFKTKTIDRLENRLQSYQVEIDDLQEEFERDR--EDYLDSIRKQEQTIKLQQQIIDK 617 Query: 192 DKQTILDKCNEHH 230 + I CN ++ Sbjct: 618 IQPCIRRDCNYYN 630 >SB_25234| Best HMM Match : SMC_hinge (HMM E-Value=3.7e-28) Length = 552 Score = 30.3 bits (65), Expect = 0.93 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +3 Query: 63 EKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNEH 227 E+ D QKE QA +E Y S++ E KE + S+K+ + ++C E+ Sbjct: 13 EESTRAGDLQKEVTQASENIEKYSQSIRDLGE----KENVLTSEKKQLEEECQEN 63 >SB_46225| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00052) Length = 649 Score = 30.3 bits (65), Expect = 0.93 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 2/59 (3%) Frame = +3 Query: 30 KEEIERMVNEAEKYRNEDDK-QKETIQAKNALESYCFSMKSTMED-EKLKEKISDSDKQ 200 KE+I+ NEA++ + DK +KE +KN LES +K+ ++ +E I+ ++Q Sbjct: 2 KEDIQVRSNEAQREARKKDKLEKELKTSKNDLESKTAELKTKQSQLQRNQEDIAKLEQQ 60 >SB_42014| Best HMM Match : Myosin_tail_1 (HMM E-Value=0.083) Length = 1007 Score = 29.9 bits (64), Expect = 1.2 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Frame = +3 Query: 30 KEEIERMVNEAEKYRNEDDKQKETIQAKNA-LESYCFSMKSTMEDEKLKEKISDSDKQTI 206 + E+E+ E EK DK+K+ ++ N L S+ S + DE KE +D+ Q I Sbjct: 837 RSELEKAKGEIEKAWTLYDKEKDRLEKLNGQLIDELKSLTSVL-DEMKKESENDAQCQKI 895 Query: 207 LD 212 LD Sbjct: 896 LD 897 >SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1789 Score = 29.9 bits (64), Expect = 1.2 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 4/72 (5%) Frame = +3 Query: 12 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQA-KNALES---YCFSMKSTMEDEKLKEK 179 DKG K++ E ++ E +++ + +KE Q+ K ES C S K E EK E+ Sbjct: 1526 DKGESEKDKGESEKDKGESEKDKGESEKEKCQSEKEKCESEKEKCESEKEKCESEKKVEE 1585 Query: 180 ISDSDKQTILDK 215 D + + +++ Sbjct: 1586 SKDENPEEKIEE 1597 Score = 29.1 bits (62), Expect = 2.2 Identities = 19/84 (22%), Positives = 39/84 (46%) Frame = +3 Query: 12 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 191 DKG KE+ + + E + + + +KE +++ +E K +EK++EK D+ Sbjct: 1547 DKGESEKEKCQSEKEKCESEKEKCESEKEKCESEKKVE----ESKDENPEEKIEEKKDDT 1602 Query: 192 DKQTILDKCNEHHQVAGFQPTADK 263 + + E +V G + +K Sbjct: 1603 ASEK-KESSEEKMEVDGEEQKVEK 1625 >SB_57319| Best HMM Match : Pox_A_type_inc (HMM E-Value=6.3e-06) Length = 348 Score = 29.9 bits (64), Expect = 1.2 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = +3 Query: 12 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKN-ALESYCFSMKSTMEDEK 167 D G + EE++R+ NE EK +NE + K+ L++Y + E EK Sbjct: 132 DYGNIHAEELQRIRNELEKCKNEISDLNSKLNTKSQKLKTYKKHIGELQEREK 184 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 29.9 bits (64), Expect = 1.2 Identities = 24/101 (23%), Positives = 42/101 (41%), Gaps = 11/101 (10%) Frame = +3 Query: 15 KGRLSKEEIERMVNEAEKYRNED------DKQKETIQAKNALESYCFSMKSTMEDEKL-- 170 K +++ E +++AE + NED D E A E ++ E E++ Sbjct: 1408 KEEMAEIEKASQIDQAEDFPNEDEVPAVIDLLPENSSAFGISEEKIDGIQEAKESEEIVS 1467 Query: 171 ---KEKISDSDKQTILDKCNEHHQVAGFQPTADKEEYEHKQ 284 E+I D D ++D +E G D+EE E ++ Sbjct: 1468 SGETEEIEDEDTPVVVDILSEDTSALGISEERDEEEIEQQK 1508 >SB_35674| Best HMM Match : SH2 (HMM E-Value=0) Length = 871 Score = 29.9 bits (64), Expect = 1.2 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 4/72 (5%) Frame = +3 Query: 12 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQA-KNALES---YCFSMKSTMEDEKLKEK 179 DKG K++ E ++ E +++ + +KE Q+ K ES C S K E EK E+ Sbjct: 105 DKGESEKDKGESEKDKGESEKDKGESEKEKCQSEKEKCESEKEKCESEKEKCESEKKVEE 164 Query: 180 ISDSDKQTILDK 215 D + + +++ Sbjct: 165 SKDENPEEKIEE 176 Score = 29.1 bits (62), Expect = 2.2 Identities = 19/84 (22%), Positives = 39/84 (46%) Frame = +3 Query: 12 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 191 DKG KE+ + + E + + + +KE +++ +E K +EK++EK D+ Sbjct: 126 DKGESEKEKCQSEKEKCESEKEKCESEKEKCESEKKVE----ESKDENPEEKIEEKKDDT 181 Query: 192 DKQTILDKCNEHHQVAGFQPTADK 263 + + E +V G + +K Sbjct: 182 ASEK-KESSEEKMEVDGEEQKVEK 204 >SB_15994| Best HMM Match : Pox_A_type_inc (HMM E-Value=2e-06) Length = 364 Score = 29.9 bits (64), Expect = 1.2 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = +3 Query: 12 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKN-ALESYCFSMKSTMEDEK 167 D G + EE++R+ NE EK +NE + K+ L++Y + E EK Sbjct: 132 DYGNIHAEELQRIRNELEKCKNEISDLNSKLNTKSQKLKTYKKHIGELQEREK 184 >SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) Length = 442 Score = 29.5 bits (63), Expect = 1.6 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 2/58 (3%) Frame = +3 Query: 12 DKGRLSKEEIERMVNEAEKYRNEDDKQK--ETIQAKNALESYCFSMKSTMEDEKLKEK 179 +K RL K++ E +K + E++K+K E I AK + K E+EK+K+K Sbjct: 365 EKERLEKKQREEKDRLEKKEKKEEEKRKKEEEINAKIEEKKKREEKKKQEEEEKMKKK 422 Score = 28.7 bits (61), Expect = 2.8 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = +3 Query: 30 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEK 179 K+E ER+ +AEK + K+KE ++ K E K E+EK K++ Sbjct: 349 KKEQERLEKQAEK----EKKEKERLEKKQREEKDRLEKKEKKEEEKRKKE 394 >SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2193 Score = 29.5 bits (63), Expect = 1.6 Identities = 20/60 (33%), Positives = 30/60 (50%) Frame = +3 Query: 12 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 191 DK +L KEE E+ + E NE KQKE +A++ L++ + D K E D+ Sbjct: 1606 DKYQLEKEEAEKRLQSYEDELNEKQKQKE--KAEDNLKALKKRISDLEVDNKNLETARDN 1663 >SB_6748| Best HMM Match : Pkinase (HMM E-Value=1.7e-05) Length = 315 Score = 29.1 bits (62), Expect = 2.2 Identities = 21/86 (24%), Positives = 43/86 (50%), Gaps = 7/86 (8%) Frame = +3 Query: 15 KGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS- 191 K ++ K+++++ E ++ DDK KET+ N +ES + E++ E++S Sbjct: 229 KKQIEKQKLQQDEIEQGLLQDSDDKDKETL-GDNCIESNDMEESAKDSSEEISEELSSRL 287 Query: 192 -DKQTILD-----KCNEHHQVAGFQP 251 ++Q ++ KCN+ G +P Sbjct: 288 LEEQCVVSDEETRKCNKITPQDGEEP 313 >SB_59386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1037 Score = 29.1 bits (62), Expect = 2.2 Identities = 15/41 (36%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = +3 Query: 6 TNDKGRLSKEEIERMVNEAEKY-RNEDDKQKETIQAKNALE 125 TND G S +E E VN ++K NE++ + E ++ +N++E Sbjct: 888 TNDNGS-STDEAESEVNNSDKEGENEENDEVEDMEVENSIE 927 >SB_6077| Best HMM Match : EGF (HMM E-Value=0) Length = 1165 Score = 29.1 bits (62), Expect = 2.2 Identities = 14/50 (28%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = -1 Query: 300 CXPXLSACAHTPPCRQLVGIQPLDGVRCTCR-GWSACQSQRSFP*ASHPP 154 C ++ CA +P + + G RCTCR G++ + +R S P Sbjct: 630 CAVDINECATSPCLNEAKCTDVVSGYRCTCRSGYTGTRCERDIDECSSSP 679 >SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 28.7 bits (61), Expect = 2.8 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 2/67 (2%) Frame = +3 Query: 21 RLSKEEIERMVNEAEKYRNED--DKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSD 194 + K+E ER E EK R ++ ++KE + + E K E ++ KEK+ + + Sbjct: 316 KAKKKEKERQEREKEKEREKERIQQEKEKQKERREKEKQKHQEKKEKERQREKEKL-EKE 374 Query: 195 KQTILDK 215 KQ L++ Sbjct: 375 KQKELER 381 >SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1967 Score = 28.7 bits (61), Expect = 2.8 Identities = 18/51 (35%), Positives = 28/51 (54%) Frame = +3 Query: 24 LSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKE 176 L ++ +VNE +K + + D QK+ I+ + ES + ME EKLKE Sbjct: 1182 LKAARLKELVNELDKMKKDLDAQKQAIEESRSEES---GIIGEME-EKLKE 1228 >SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) Length = 1866 Score = 28.7 bits (61), Expect = 2.8 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +1 Query: 1 PLPTTKVVSPRKRSSVWLMRQRSTETRMTSKRR 99 PLP T V R R WL + E+ TSK+R Sbjct: 297 PLPET-VAEERSRKGSWLRSLKKNESEKTSKKR 328 >SB_44787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 28.3 bits (60), Expect = 3.8 Identities = 15/52 (28%), Positives = 28/52 (53%) Frame = +3 Query: 30 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKIS 185 K+E R+ +EAEK E++K K+ + + + Y ++ + K K+K S Sbjct: 467 KDEQSRLFDEAEKLEKENNKLKDEVGSLSKEIEYLKNLMLEVYQTKQKQKES 518 >SB_12412| Best HMM Match : Kinesin (HMM E-Value=6.3e-15) Length = 1001 Score = 28.3 bits (60), Expect = 3.8 Identities = 19/87 (21%), Positives = 41/87 (47%), Gaps = 4/87 (4%) Frame = +3 Query: 33 EEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKL----KEKISDSDKQ 200 E+ E++ E + + +++ I+ ++ +M+S E++ + K K ++ ++ Sbjct: 635 EDEEKVEGELAALTTDIEIKQKLIEELEIAQNKIQTMRSQYEEKLVLLTHKIKETEEERD 694 Query: 201 TILDKCNEHHQVAGFQPTADKEEYEHK 281 +L EH + Q KEEYE K Sbjct: 695 HVLKNIKEHDSESSKQAAKLKEEYEKK 721 >SB_23774| Best HMM Match : Kinesin (HMM E-Value=0) Length = 805 Score = 28.3 bits (60), Expect = 3.8 Identities = 17/55 (30%), Positives = 31/55 (56%) Frame = +3 Query: 33 EEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDK 197 EE+E + + E+ R+ + Q ET++ +N E K T E++ LKE I+ ++ Sbjct: 54 EELEDRIAKLEEERDNLEVQLETVRKENDTE----MEKQTNENDTLKETITGHEE 104 >SB_54892| Best HMM Match : DHH (HMM E-Value=0.057) Length = 384 Score = 27.9 bits (59), Expect = 5.0 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = +3 Query: 12 DKGRLSKEEIERMVNEAEKYRNED-DKQKETIQAKNALESYCFSMKSTMEDEKLKEKISD 188 DK + + EE+ VNEA K E KQ++T Q+ + + C ++ E+ S+ Sbjct: 156 DKVKFNLEELYHSVNEATKRNTEAIQKQRQTRQSPASPGTICRLYNKKLDFEQFDYGFSE 215 Query: 189 SDK 197 + K Sbjct: 216 TIK 218 >SB_40334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1061 Score = 27.9 bits (59), Expect = 5.0 Identities = 16/62 (25%), Positives = 30/62 (48%) Frame = +3 Query: 9 NDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISD 188 +D ++ EE E ++AE E D++ +A ++ S +D++L EK+ D Sbjct: 975 SDASHVTSEE-EMQASDAESEEKEKDEESSDAEAPSSSRKRVISSD---DDDELDEKLDD 1030 Query: 189 SD 194 D Sbjct: 1031 DD 1032 >SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 903 Score = 27.9 bits (59), Expect = 5.0 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = +3 Query: 30 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQ 200 +EE ER E K E+ KQ+E + K E + E+E+ K+K + +K+ Sbjct: 448 REEEERREEEERKREEEERKQREEEEKKREEEE-----RKQREEEERKQKEKEEEKK 499 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 27.9 bits (59), Expect = 5.0 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +3 Query: 3 ITNDKGRLSKEEIER--MVNEAEKYRNEDDKQKETIQAKNA 119 ITN G++ KEE +R V E++K K++E I+ K A Sbjct: 1145 ITNAMGKIEKEEAKRKAAVEESQKAIEAARKKQEEIRQKQA 1185 >SB_45987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 27.9 bits (59), Expect = 5.0 Identities = 14/59 (23%), Positives = 32/59 (54%) Frame = +3 Query: 3 ITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEK 179 I +D G L ++ N+ +K + E+D+ +E + E++ SM+ + D++ +E+ Sbjct: 978 IYDDDGDLKVSKLTGFFNDDDKEKEEEDRAEECEET----EAHIISMQEEVNDDETEEE 1032 >SB_11774| Best HMM Match : M (HMM E-Value=8.5e-09) Length = 1998 Score = 27.9 bits (59), Expect = 5.0 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = +3 Query: 33 EEIERMVNE-AEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISD 188 E+ E+++ + AEK R +K+KE + E F + + +DE L +K+ D Sbjct: 1446 EKREKVLQDGAEKDRKGFEKEKEEFEEAFRKEKKIFQDELSKKDEDLAQKLQD 1498 >SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) Length = 1683 Score = 27.5 bits (58), Expect = 6.6 Identities = 19/72 (26%), Positives = 35/72 (48%), Gaps = 1/72 (1%) Frame = +3 Query: 15 KGRLSKEEIERMVNEAEKYRNEDDKQKETIQ-AKNALESYCFSMKSTMEDEKLKEKISDS 191 K R + +++ + A + + DK + IQ +NA +S +KSTM +K K+ D Sbjct: 512 KIRRLEVQVDNLAQLASSLKKDKDKVSKQIQDLRNATQSAIKKIKSTM----MKRKMIDE 567 Query: 192 DKQTILDKCNEH 227 ++ + N H Sbjct: 568 VYCDLVKRVNHH 579 >SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2848 Score = 27.5 bits (58), Expect = 6.6 Identities = 21/81 (25%), Positives = 38/81 (46%) Frame = +3 Query: 27 SKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTI 206 ++E IE++ E + ++ +++ + +K E+ K+ ME E KI + Sbjct: 2183 AEETIEQLRGELDLFKTSGNEKHAQLSSKLENENLA---KNRMESEISSLKIRLENANNE 2239 Query: 207 LDKCNEHHQVAGFQPTADKEE 269 LDK N QV+ Q +EE Sbjct: 2240 LDKANTARQVSERQMHELREE 2260 >SB_3000| Best HMM Match : Extensin_2 (HMM E-Value=0.058) Length = 1002 Score = 27.5 bits (58), Expect = 6.6 Identities = 20/71 (28%), Positives = 33/71 (46%) Frame = +3 Query: 9 NDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISD 188 N+K +L ++E+ER + E ++E + A + S E KLKE+ Sbjct: 680 NEKAKLHRQELERKMQEEAMKKHETELD---YLAPFLAQIGDPPRISRQEAYKLKEECLQ 736 Query: 189 SDKQTILDKCN 221 KQ ++DK N Sbjct: 737 DLKQRLIDKAN 747 >SB_54051| Best HMM Match : WSC (HMM E-Value=1.8e-08) Length = 93 Score = 27.5 bits (58), Expect = 6.6 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = -1 Query: 276 AHTPPCRQLVGIQPLDGVRCTCRGWSACQSQRS 178 A T P ++ GI LD RC RG+ C Q S Sbjct: 17 AGTGPPLEVDGIDKLDTSRCRARGYRYCGLQAS 49 >SB_48456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 365 Score = 27.5 bits (58), Expect = 6.6 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (9%) Frame = +3 Query: 144 KSTMEDEKLKEKISDS-DKQTI---LDKCNEHHQVAGFQPTA 257 KS++ D+K E++ S + +T+ + E H + G QPTA Sbjct: 79 KSSLHDQKSNEQVQVSPEPETVTVTISAAGEEHTIVGQQPTA 120 >SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3934 Score = 27.5 bits (58), Expect = 6.6 Identities = 15/48 (31%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +3 Query: 60 AEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISD-SDKQ 200 AEKY +E ++K+ ++ LES + + E L++K+S+ S+K+ Sbjct: 2091 AEKYEHESQEKKKIVEISETLESKNRKQQELL--ESLEKKLSEFSEKE 2136 >SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) Length = 418 Score = 27.5 bits (58), Expect = 6.6 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +3 Query: 33 EEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK 167 E E + N+ ++ +DDK++ET K + + S EDEK Sbjct: 40 EAAEEVENKMDEMSVKDDKREETQSDKKSAKESTKSSSKPAEDEK 84 >SB_18255| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1457 Score = 27.5 bits (58), Expect = 6.6 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +3 Query: 30 KEEIERMVNEAEKYRNEDDKQKETIQ-AKNALESYCFSMKSTMEDEKLKEKISDSDK 197 KE E +NE +KY N+ K +Q KNAL+ + S D L K + ++ Sbjct: 811 KERSEAWLNEKQKYTNDIKHIKTEVQLCKNALDGTKQKVLSLENDLLLTSKQLEKER 867 >SB_3240| Best HMM Match : Sec8_exocyst (HMM E-Value=0.48) Length = 643 Score = 27.5 bits (58), Expect = 6.6 Identities = 18/52 (34%), Positives = 24/52 (46%) Frame = +3 Query: 21 RLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKE 176 R S EE+ R E E E K +ETIQ N E MK + D+ ++ Sbjct: 380 RASVEELVRTRKELEMKEKELQKAQETIQQMNEREQ---QMKERLADQAQRQ 428 >SB_59138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 27.1 bits (57), Expect = 8.7 Identities = 17/59 (28%), Positives = 25/59 (42%) Frame = +3 Query: 96 ETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNEHHQVAGFQPTADKEEY 272 +T Q ++ L Y +M T K D+D T+ + H A Q +ADK Y Sbjct: 31 DTDQTRSRLRKYT-AMTQTRHYRDQNRKPYDTDTTTVTTRTRHGHFAATHQMSADKGVY 88 >SB_58677| Best HMM Match : Pkinase (HMM E-Value=2.8e-33) Length = 834 Score = 27.1 bits (57), Expect = 8.7 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 33 EEIERMVNEAEKYRNEDDKQKETIQAKNALE 125 + I + + EKYRNE D K+T+ + L+ Sbjct: 720 QAISDFMQKDEKYRNESDDLKKTVYSTKKLQ 750 >SB_32331| Best HMM Match : DivIVA (HMM E-Value=0.86) Length = 888 Score = 27.1 bits (57), Expect = 8.7 Identities = 14/59 (23%), Positives = 31/59 (52%) Frame = +3 Query: 3 ITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEK 179 I +D G L ++ N+ +K E+D+ +E + E++ SM+ + D++ +E+ Sbjct: 621 IYDDDGDLKVSKLTGFFNDDDKEEEEEDRAEECEET----EAHIISMQEEVNDDETEEE 675 >SB_26314| Best HMM Match : SURF6 (HMM E-Value=2.8) Length = 222 Score = 27.1 bits (57), Expect = 8.7 Identities = 19/80 (23%), Positives = 40/80 (50%), Gaps = 2/80 (2%) Frame = +3 Query: 9 NDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKN--ALESYCFSMKSTMEDEKLKEKI 182 +DK +E E+ +E EK +ED+K + + + E++ K+ ED+K ++ Sbjct: 62 HDKDEKKHDEDEKNHDEDEKNHDEDEKNHDEDEKNHDEDEENHDEDEKNHDEDDKCYDED 121 Query: 183 SDSDKQTILDKCNEHHQVAG 242 + Q+ + +E +V+G Sbjct: 122 RVEEPQSGQESASESGEVSG 141 >SB_23940| Best HMM Match : MuDR (HMM E-Value=0.24) Length = 685 Score = 27.1 bits (57), Expect = 8.7 Identities = 14/59 (23%), Positives = 31/59 (52%) Frame = +3 Query: 3 ITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEK 179 I +D G L ++ N+ +K E+D+ +E + E++ SM+ + D++ +E+ Sbjct: 451 IYDDDGDLKVSKLTGFFNDDDKEEEEEDRAEECEET----EAHIISMQEEVNDDETEEE 505 >SB_22651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 950 Score = 27.1 bits (57), Expect = 8.7 Identities = 23/94 (24%), Positives = 41/94 (43%), Gaps = 7/94 (7%) Frame = +3 Query: 15 KGRLSKEEIERMVNEAEKYRNEDDK-QKETIQAK---NALESYCFSMKSTMEDEKLKEKI 182 K +EE E E + E +K K+ ++AK + +S C S + + E+E +E Sbjct: 641 KPEKEEEESEEESEEESEEEEETEKVNKDALKAKATEKSNDSLCLSEEESEEEESEEESE 700 Query: 183 SDSD---KQTILDKCNEHHQVAGFQPTADKEEYE 275 D + K + K + + P DK++ E Sbjct: 701 EDEEEGAKPSASAKIAKTSETENKVPKVDKDDEE 734 >SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) Length = 703 Score = 27.1 bits (57), Expect = 8.7 Identities = 16/66 (24%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = +3 Query: 12 DKGRLSKEEIERMVNEAEKYRNEDDKQK-ETIQAKNALESYCFSMKSTMEDEKLKEKISD 188 ++ R E R EAE+ R E +K+K E +A+ + + ++E+LK + D Sbjct: 179 EEARKKAEAKARFEQEAERRRREAEKRKAEEEEARRKADELEKIKRQQEDEERLKNQRLD 238 Query: 189 SDKQTI 206 +++ + Sbjct: 239 EERKKL 244 >SB_3878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 243 Score = 27.1 bits (57), Expect = 8.7 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 5/61 (8%) Frame = +3 Query: 30 KEEIERM--VNEAEKYRN-EDDKQKETIQAK--NALESYCFSMKSTMEDEKLKEKISDSD 194 KEEIE NE E+ EDD +KE I+ + + + + E+E+++E+ D D Sbjct: 157 KEEIEEREDANEKEEIEEREDDNEKEEIEEREDDNEKEEIDEREDDNEEEEIEEREDDDD 216 Query: 195 K 197 + Sbjct: 217 E 217 >SB_52390| Best HMM Match : Cauli_DNA-bind (HMM E-Value=6.4) Length = 232 Score = 27.1 bits (57), Expect = 8.7 Identities = 14/59 (23%), Positives = 31/59 (52%) Frame = +3 Query: 3 ITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEK 179 I +D G L ++ N+ +K E+D+ +E + E++ SM+ + D++ +E+ Sbjct: 90 IYDDDGDLKVSKLTGFFNDDDKEEEEEDRAEECEET----EAHIISMQEEVNDDETEEE 144 >SB_49663| Best HMM Match : TolA (HMM E-Value=0.059) Length = 591 Score = 27.1 bits (57), Expect = 8.7 Identities = 13/53 (24%), Positives = 28/53 (52%) Frame = +3 Query: 48 MVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTI 206 M + E+ + + K++E Q + E +++ + E LKE + + +K+TI Sbjct: 182 MRKKEEERMSRERKERERRQQEFIKEQKDVAVQQKAQQESLKETLQEQEKETI 234 >SB_32504| Best HMM Match : TolA (HMM E-Value=0.52) Length = 422 Score = 27.1 bits (57), Expect = 8.7 Identities = 18/66 (27%), Positives = 33/66 (50%) Frame = +3 Query: 6 TNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKIS 185 T + L +++I R +++K E+ K+KE + K + + K E EK KEK Sbjct: 112 TENHSLLEEKDIPRD-KKSDKELKEEKKEKEKERMKKEEKHKEKTRKEEKEREKEKEKTK 170 Query: 186 DSDKQT 203 +K++ Sbjct: 171 KEEKES 176 >SB_8304| Best HMM Match : PLAT (HMM E-Value=0) Length = 1182 Score = 27.1 bits (57), Expect = 8.7 Identities = 21/85 (24%), Positives = 43/85 (50%) Frame = +3 Query: 30 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 209 KEE + E EK + ED+ ++E + +E+ +K +EDE K+++ + +K+T Sbjct: 642 KEEERKRREEEEKKKREDEVKREEEGRRQKVEA---ELK-LIEDEH-KQRLEELEKKTKK 696 Query: 210 DKCNEHHQVAGFQPTADKEEYEHKQ 284 ++ + + D+ + E KQ Sbjct: 697 EEEKKRSEHVNNDEELDRLQEEIKQ 721 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,356,283 Number of Sequences: 59808 Number of extensions: 243006 Number of successful extensions: 1204 Number of sequences better than 10.0: 63 Number of HSP's better than 10.0 without gapping: 1065 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1182 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1087245449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -