BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30453 (597 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY062197-1|AAL58558.1| 150|Anopheles gambiae cytochrome P450 CY... 23 7.5 AJ618923-1|CAF02002.1| 155|Anopheles gambiae odorant-binding pr... 23 9.9 >AY062197-1|AAL58558.1| 150|Anopheles gambiae cytochrome P450 CYP4C27 protein. Length = 150 Score = 23.0 bits (47), Expect = 7.5 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +2 Query: 329 SLNLYQLILSQTVILGEQEQTNNTIIKVHIYRL 427 S++ + LS+ V LG + TI+ +H Y + Sbjct: 74 SVSFFGRTLSEDVQLGGHQVPAQTIVGIHAYHV 106 >AJ618923-1|CAF02002.1| 155|Anopheles gambiae odorant-binding protein OBPjj5c protein. Length = 155 Score = 22.6 bits (46), Expect = 9.9 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Frame = +3 Query: 42 NNTIT--NFLCTVTTHIYTISDSQSTFLRKIFLNKLLPMCI 158 N+T+T + + + Y I+ S +LR + N + P CI Sbjct: 65 NDTLTWQHVIEVASKKCYIITVGDSFYLRDVAKNLISPQCI 105 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 541,911 Number of Sequences: 2352 Number of extensions: 10926 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -