BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30451 (716 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC12C2.05c |||diacylglycerol binding protein Bzz1 |Schizosacch... 27 3.5 SPBC11B10.01 |alg2|SPBC32H8.14|mannosyltransferase complex subun... 27 3.5 SPBC660.07 |ntp1||alpha,alpha-trehalase Ntp1|Schizosaccharomyces... 25 8.2 >SPBC12C2.05c |||diacylglycerol binding protein Bzz1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 642 Score = 26.6 bits (56), Expect = 3.5 Identities = 15/50 (30%), Positives = 30/50 (60%), Gaps = 2/50 (4%) Frame = +2 Query: 302 IKYMYFLHGYQVSNQSDAWFSSYNV-TSVKTTV-DLFISIDNYDAKNKHV 445 + +M L+ Y+VSN ++ W +S+++ S+ T+ + I + AKN+ V Sbjct: 221 LNHMQVLNEYRVSNLNEIWCNSFSIEKSLHDTLSQRTVEIQSEIAKNEPV 270 >SPBC11B10.01 |alg2|SPBC32H8.14|mannosyltransferase complex subunit Alg2|Schizosaccharomyces pombe|chr 2|||Manual Length = 511 Score = 26.6 bits (56), Expect = 3.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 50 CVLSASFLTFSIA*KLTQI 106 C++S SFLTF++ KLT + Sbjct: 493 CIVSVSFLTFTVYAKLTNL 511 >SPBC660.07 |ntp1||alpha,alpha-trehalase Ntp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 735 Score = 25.4 bits (53), Expect = 8.2 Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = +2 Query: 314 YFLHGYQVSNQS-DAWFSSYNVTSVKTTVDLFISIDNYDAKNKHVSILDFGQKFV 475 YF+H V D + V + TVDL + Y+ HV + F KFV Sbjct: 444 YFVHDRAVRESGHDTTYRLEKVCADLATVDLNSLLYKYETDISHVILEYFDDKFV 498 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,467,546 Number of Sequences: 5004 Number of extensions: 41864 Number of successful extensions: 101 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 99 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 101 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 335201398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -