BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30451 (716 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. 24 1.2 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 24 1.2 AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. 24 1.2 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 22 5.0 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 22 5.0 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 22 6.7 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 22 6.7 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 22 6.7 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 22 6.7 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 22 6.7 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 22 6.7 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 22 6.7 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 22 6.7 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 22 6.7 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 22 6.7 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 6.7 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 8.8 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 8.8 AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 21 8.8 >DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. Length = 132 Score = 24.2 bits (50), Expect = 1.2 Identities = 11/29 (37%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = -3 Query: 522 SSKSNKLSHSIKQTNETNFCPK-SRMLTC 439 S + N+L ++ K E+N C K S++L C Sbjct: 93 SEQVNRLVNNCKDITESNSCKKSSKLLQC 121 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 24.2 bits (50), Expect = 1.2 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -1 Query: 692 KSTFKFYHSESLPLPLQSNTKVTVVEGMRYNN 597 +S F FYH E LP V +EG + + Sbjct: 341 RSLFDFYHPEDLPFIKDIYETVIKLEGASFRS 372 >AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. Length = 238 Score = 24.2 bits (50), Expect = 1.2 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -1 Query: 692 KSTFKFYHSESLPLPLQSNTKVTVVEGMRYNN 597 +S F FYH E LP V +EG + + Sbjct: 47 RSLFDFYHPEDLPFIKDIYETVIKLEGASFRS 78 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 22.2 bits (45), Expect = 5.0 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = -1 Query: 713 NNMRNHSKSTFKFYHSESLPLPL 645 NN N+ K + + E +P+P+ Sbjct: 101 NNYNNYKKLYYNINYIEQIPIPV 123 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 22.2 bits (45), Expect = 5.0 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -1 Query: 716 GNNMRNHSKSTFKFYHSESLPLPLQSNTKVTVVEGMR 606 GN++ H K F SLP P+ + T TV + +R Sbjct: 137 GNHLPFHEKLVESFPRGGSLPTPV-TPTPTTVQQLLR 172 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.7 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = -1 Query: 713 NNMRNHSKSTFKFYHSESLPLPL 645 NN N+ K + + E +P+P+ Sbjct: 101 NNYNNYKKLYYNINYIEQIPVPV 123 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.7 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = -1 Query: 713 NNMRNHSKSTFKFYHSESLPLPL 645 NN N+ K + + E +P+P+ Sbjct: 101 NNYNNYKKLYYNINYIEQIPVPV 123 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.7 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = -1 Query: 713 NNMRNHSKSTFKFYHSESLPLPL 645 NN N+ K + + E +P+P+ Sbjct: 101 NNYNNYKKLYYNINYIEQIPVPV 123 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.7 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = -1 Query: 713 NNMRNHSKSTFKFYHSESLPLPL 645 NN N+ K + + E +P+P+ Sbjct: 101 NNYNNYKKLYYNINYIEQIPVPV 123 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.7 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = -1 Query: 713 NNMRNHSKSTFKFYHSESLPLPL 645 NN N+ K + + E +P+P+ Sbjct: 101 NNYNNYKKLYYNINYIEQIPVPV 123 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.7 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = -1 Query: 713 NNMRNHSKSTFKFYHSESLPLPL 645 NN N+ K + + E +P+P+ Sbjct: 101 NNYNNYKKLYYNINYIEQIPVPV 123 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.7 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = -1 Query: 713 NNMRNHSKSTFKFYHSESLPLPL 645 NN N+ K + + E +P+P+ Sbjct: 101 NNYNNYKKLYYNINYIEQIPVPV 123 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 6.7 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = -1 Query: 713 NNMRNHSKSTFKFYHSESLPLPL 645 NN N+ K + + E +P+P+ Sbjct: 99 NNYNNYKKLYYNINYIEQVPVPI 121 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 21.8 bits (44), Expect = 6.7 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = -1 Query: 713 NNMRNHSKSTFKFYHSESLPLPL 645 NN N+ K + + E +P+P+ Sbjct: 109 NNYNNYKKLYYNINYIEQIPVPV 131 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.8 bits (44), Expect = 6.7 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = -1 Query: 713 NNMRNHSKSTFKFYHSESLPLPL 645 NN N+ K + + E +P+P+ Sbjct: 344 NNYNNYKKLYYNIINIEQIPVPV 366 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 6.7 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +3 Query: 300 PLSTCIFCMDTK 335 PL C FC+D K Sbjct: 423 PLDKCYFCLDGK 434 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 8.8 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +3 Query: 486 VLWSGKVCYFCCL 524 V W+GKV YF L Sbjct: 228 VKWTGKVVYFTSL 240 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 8.8 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +3 Query: 486 VLWSGKVCYFCCL 524 V W+GKV YF L Sbjct: 281 VKWTGKVVYFTSL 293 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 21.4 bits (43), Expect = 8.8 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +3 Query: 513 FCCLGRCSNCIQI 551 + C GRCS+ +Q+ Sbjct: 51 YACRGRCSSYLQV 63 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,820 Number of Sequences: 438 Number of extensions: 3020 Number of successful extensions: 20 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -