BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30438 (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12080| Best HMM Match : p450 (HMM E-Value=0) 31 0.90 SB_5584| Best HMM Match : p450 (HMM E-Value=1) 30 2.1 SB_21299| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_38287| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_49449| Best HMM Match : Smg4_UPF3 (HMM E-Value=4.7) 28 8.4 SB_13698| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_12080| Best HMM Match : p450 (HMM E-Value=0) Length = 522 Score = 31.1 bits (67), Expect = 0.90 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +3 Query: 141 KKNDLAHFVFSLSKVEWFARRSVYSLTLARPKL 239 +K AH VFSL+ EW RSV + + +PK+ Sbjct: 136 EKRKQAHGVFSLNGEEWLKARSVLNKKMLKPKV 168 >SB_5584| Best HMM Match : p450 (HMM E-Value=1) Length = 286 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 141 KKNDLAHFVFSLSKVEWFARRSVYSLTLARPKL 239 +K AH VFS EWF RSV + + +PK+ Sbjct: 103 EKRKQAHGVFSSLGEEWFKARSVLNKKMLKPKV 135 >SB_21299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2630 Score = 28.7 bits (61), Expect = 4.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +1 Query: 496 YENIKFFCCFEFGMNGNFILLNL 564 Y+ + +CC FG G +I+ NL Sbjct: 178 YDAVSAYCCARFGRGGGYIVANL 200 >SB_38287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 258 Score = 27.9 bits (59), Expect = 8.4 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 2/67 (2%) Frame = -3 Query: 204 SVSRTTRPWRGKRQSE--LDRFSCTQHSLLQEKFNLMMKNEKNHNTTDRKRSFASFTRTI 31 ++ +TT+P RGKRQ+ L F + L Q L + + + R ++ S T T Sbjct: 27 TIGQTTKPNRGKRQAHVYLREFDSCEIMLPQHTRILQVSPLQEFYKSHRYKNSTSLTVTR 86 Query: 30 ILTVEDI 10 IL V + Sbjct: 87 ILQVSSL 93 >SB_49449| Best HMM Match : Smg4_UPF3 (HMM E-Value=4.7) Length = 258 Score = 27.9 bits (59), Expect = 8.4 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 2/67 (2%) Frame = -3 Query: 204 SVSRTTRPWRGKRQSE--LDRFSCTQHSLLQEKFNLMMKNEKNHNTTDRKRSFASFTRTI 31 ++ +TT+P RGKRQ+ L F + L Q L + + + R ++ S T T Sbjct: 27 TIGQTTKPNRGKRQAHVYLREFDSCEIMLPQHTRILQVSPLQEFYKSHRYKNSTSLTVTR 86 Query: 30 ILTVEDI 10 IL V + Sbjct: 87 ILQVSSL 93 >SB_13698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = -1 Query: 626 RSVNINYPVTIFR*LLEVSPFKFNKIKFP-FMPNSKQQKNLI 504 R+VNI +PV + LL ++ ++ I P FMP+ K K L+ Sbjct: 114 RAVNIAFPVITIQNLLVIALERYVAIFHPFFMPSIKTVKRLV 155 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,993,725 Number of Sequences: 59808 Number of extensions: 353546 Number of successful extensions: 696 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 662 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 696 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -