SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= heS30437
         (737 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g56570.1 68418.m07059 hypothetical protein similar to unknown...    28   7.4  
At5g05910.1 68418.m00653 zinc finger (C3HC4-type RING finger) fa...    28   7.4  

>At5g56570.1 68418.m07059 hypothetical protein similar to unknown
           protein (pir |T06019)
          Length = 439

 Score = 27.9 bits (59), Expect = 7.4
 Identities = 17/48 (35%), Positives = 22/48 (45%)
 Frame = +2

Query: 455 IKKNVKL*LHF*RHKTMFLEILDTWPSFRCICIKRCSNPAKQGTNFSN 598
           IK N+++  H       F+E L T     C+C     NP   GT FSN
Sbjct: 271 IKANIEV-AHDQSQSVKFIESL-TSTRHLCLCSPTSENPYPNGTKFSN 316


>At5g05910.1 68418.m00653 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger)
          Length = 151

 Score = 27.9 bits (59), Expect = 7.4
 Identities = 9/12 (75%), Positives = 11/12 (91%)
 Frame = -3

Query: 504 IVLCLQKCNHSF 469
           +V+CL KCNHSF
Sbjct: 109 VVVCLSKCNHSF 120


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,356,143
Number of Sequences: 28952
Number of extensions: 278015
Number of successful extensions: 528
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 513
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 528
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1624036432
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -