BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30437 (737 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g56570.1 68418.m07059 hypothetical protein similar to unknown... 28 7.4 At5g05910.1 68418.m00653 zinc finger (C3HC4-type RING finger) fa... 28 7.4 >At5g56570.1 68418.m07059 hypothetical protein similar to unknown protein (pir |T06019) Length = 439 Score = 27.9 bits (59), Expect = 7.4 Identities = 17/48 (35%), Positives = 22/48 (45%) Frame = +2 Query: 455 IKKNVKL*LHF*RHKTMFLEILDTWPSFRCICIKRCSNPAKQGTNFSN 598 IK N+++ H F+E L T C+C NP GT FSN Sbjct: 271 IKANIEV-AHDQSQSVKFIESL-TSTRHLCLCSPTSENPYPNGTKFSN 316 >At5g05910.1 68418.m00653 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 151 Score = 27.9 bits (59), Expect = 7.4 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -3 Query: 504 IVLCLQKCNHSF 469 +V+CL KCNHSF Sbjct: 109 VVVCLSKCNHSF 120 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,356,143 Number of Sequences: 28952 Number of extensions: 278015 Number of successful extensions: 528 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 513 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 528 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1624036432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -