BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30428 (385 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 28 0.037 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 28 0.037 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 23 1.4 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 21 5.6 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 27.9 bits (59), Expect = 0.037 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = -1 Query: 217 RTHYEWNVIILNVV---TVFFQIEGAGLFSE 134 RT+ EW V L VV TVFF + GA + S+ Sbjct: 50 RTYIEWGVKFLKVVTIITVFFVVLGAAVVSK 80 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 27.9 bits (59), Expect = 0.037 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = -1 Query: 217 RTHYEWNVIILNVV---TVFFQIEGAGLFSE 134 RT+ EW V L VV TVFF + GA + S+ Sbjct: 50 RTYIEWGVKFLKVVTIITVFFVVLGAAVVSK 80 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 22.6 bits (46), Expect = 1.4 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = -1 Query: 247 VVKMSSIWSDRTHYEWNVIILNVVTVFF 164 V M W D ++W V I V V F Sbjct: 188 VQSMPQCWIDLQTWQWKVYITLVALVLF 215 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 20.6 bits (41), Expect = 5.6 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +1 Query: 256 YDGSYADTTSIETMREWHRPRIQALVEAGVDLLALET 366 Y+G D T+ + R + + VEAG D + E+ Sbjct: 53 YEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYES 89 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,267 Number of Sequences: 336 Number of extensions: 1770 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8014124 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -