Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= heS30421
         (581 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_01_0071 - 507595-507762,508027-508155,508567-508752,509306-50...    41   6e-04

>08_01_0071 -
           507595-507762,508027-508155,508567-508752,509306-509381,
           509477-509559,509778-509885,510420-510497,511762-511827
          Length = 297

 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 20/66 (30%), Positives = 34/66 (51%)
 Frame = +1

Query: 292 LAAEERDPATRHYSKWIIGEKCLAKWRADGMFXEALIXEVLEDXLXVKFDGYTTLEVVSL 471
           L +E  D  ++ + K+ +G K  A W  DG +  A I E+ E+   V F+G+   E V  
Sbjct: 81  LQSEALDDPSQSHEKFAVGTKVQAVWSEDGEWYNATIEELTENGYYVSFEGWGNKEEVDP 140

Query: 472 TDIKPL 489
            +++ L
Sbjct: 141 ANVRSL 146


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,294,784
Number of Sequences: 37544
Number of extensions: 163673
Number of successful extensions: 257
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 255
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 257
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1364465340
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)