BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30420 (621 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC584.11c |||Svf1 family protein Svf1|Schizosaccharomyces pomb... 27 2.9 SPAC3H1.11 |hsr1||transcription factor Hsr1|Schizosaccharomyces ... 25 6.7 SPBC146.13c |myo1||myosin type I|Schizosaccharomyces pombe|chr 2... 25 6.7 >SPCC584.11c |||Svf1 family protein Svf1|Schizosaccharomyces pombe|chr 3|||Manual Length = 380 Score = 26.6 bits (56), Expect = 2.9 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +3 Query: 210 ASSFCGLKDKKYPDRALWDSRSTDLQAAPPASRTSF 317 A S C + D K+P+ LW S + D Q + +TSF Sbjct: 88 AQSTCRIFDLKHPENDLWTSTNMD-QFSFENDKTSF 122 >SPAC3H1.11 |hsr1||transcription factor Hsr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 582 Score = 25.4 bits (53), Expect = 6.7 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 46 TTSLPSITAAAAGPSTCSCPRALKPACPS 132 T S ++ A++ PS CSCP ++K + PS Sbjct: 301 TVSSGPLSTASSIPSNCSCP-SVKSSGPS 328 >SPBC146.13c |myo1||myosin type I|Schizosaccharomyces pombe|chr 2|||Manual Length = 1217 Score = 25.4 bits (53), Expect = 6.7 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 323 LVE*SPGGWWRCLKVGRTG 267 +V+ P GWW LK G G Sbjct: 1135 IVQKEPSGWWLALKNGAEG 1153 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,435,890 Number of Sequences: 5004 Number of extensions: 50478 Number of successful extensions: 105 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 105 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 273658928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -