SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= heS30420
         (621 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF053356-1|AAC78790.1| 2379|Homo sapiens zonadhesin protein.           32   1.4  

>AF053356-1|AAC78790.1| 2379|Homo sapiens zonadhesin protein.
          Length = 2379

 Score = 32.3 bits (70), Expect = 1.4
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 4/52 (7%)
 Frame = +1

Query: 4    HSATYPLRAMILDATTSLPSITAAAAGPS----TCSCPRALKPACPSNCSLC 147
            H+ + P+ ++IL  TT+  S T  +  P+    +C+CP + K   PS   LC
Sbjct: 930  HAPSTPMTSVILGTTTTSRSSTGMSCPPNARYESCACPASCKSPRPSCGPLC 981


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 87,358,411
Number of Sequences: 237096
Number of extensions: 1905455
Number of successful extensions: 4847
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 4587
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4844
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6691573490
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -