BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30417 (616 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23833| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_31467| Best HMM Match : CTP_transf_2 (HMM E-Value=0.85) 31 0.56 SB_6713| Best HMM Match : Response_reg (HMM E-Value=0.34) 29 4.0 SB_42005| Best HMM Match : Myosin_head (HMM E-Value=0) 28 5.2 SB_46391| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_45755| Best HMM Match : GPW_gp25 (HMM E-Value=0.47) 28 6.9 SB_12796| Best HMM Match : Radical_SAM (HMM E-Value=8.9e-24) 28 6.9 SB_42304| Best HMM Match : NHL (HMM E-Value=0) 27 9.1 SB_6486| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 >SB_23833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 42.3 bits (95), Expect = 3e-04 Identities = 14/27 (51%), Positives = 21/27 (77%) Frame = +2 Query: 260 MIPHKTERGKNALRXLRTYDGCPPPFD 340 MIPHKT++G A+ ++ +DG PPP+D Sbjct: 1 MIPHKTKKGTEAMNRMKVFDGVPPPYD 27 >SB_31467| Best HMM Match : CTP_transf_2 (HMM E-Value=0.85) Length = 1459 Score = 31.5 bits (68), Expect = 0.56 Identities = 11/37 (29%), Positives = 23/37 (62%) Frame = +1 Query: 28 SMAVVICWAVWRQSSPRSFSKGTKLLWFAANKSISLA 138 SM+V +C ++W + P F +L+W+ + S+S++ Sbjct: 265 SMSVSLCQSIWYHTHPSVFVSLGQLIWYNTHPSVSVS 301 >SB_6713| Best HMM Match : Response_reg (HMM E-Value=0.34) Length = 225 Score = 28.7 bits (61), Expect = 4.0 Identities = 10/37 (27%), Positives = 20/37 (54%) Frame = -1 Query: 205 RAGFTLHLLRRNDISLSLFLKKLPEILICSQRTTTTL 95 R G+ + + ++ ++ LFL PE++ R TT + Sbjct: 131 RGGYNCSVCKTSEAAMELFLNNQPEVIFIDMRDTTPI 167 >SB_42005| Best HMM Match : Myosin_head (HMM E-Value=0) Length = 621 Score = 28.3 bits (60), Expect = 5.2 Identities = 15/53 (28%), Positives = 28/53 (52%) Frame = -1 Query: 259 ASTVFHRILDGALKWKGPRAGFTLHLLRRNDISLSLFLKKLPEILICSQRTTT 101 A++ H + AL+W+G R FTL + + + LS + K + + C ++T Sbjct: 525 ATSCEHEVWYQALRWRGERVYFTLIMPWMSRVPLSQPIPKRSDRVSCGALSST 577 >SB_46391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 27.9 bits (59), Expect = 6.9 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 12/57 (21%) Frame = +3 Query: 24 VIDGRGHLLGRLAAVIAKVLL------------EGNKVVVVRCEQINISGNFFRNKL 158 +IDGR + GRLA I ++L G+ VVV+ + I +SG + NKL Sbjct: 20 LIDGRDQICGRLAGYIGQILQGKTKPIYHHAEDVGDYVVVINTKHIVLSGTKWDNKL 76 >SB_45755| Best HMM Match : GPW_gp25 (HMM E-Value=0.47) Length = 624 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/48 (25%), Positives = 20/48 (41%) Frame = +2 Query: 392 PGRNYCHVGRLSHEIGWKYRDVVRKLEDKRXGXAVXRVAMKRNLRGSP 535 PG+ C VG+L + W + + R L + A R + +P Sbjct: 535 PGKQLCLVGQLGYRGRWSFSVIDRPLHTRELAAAFTRTPAAKQRANNP 582 >SB_12796| Best HMM Match : Radical_SAM (HMM E-Value=8.9e-24) Length = 676 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = -3 Query: 416 LHDSNYGQVSDRRHVEQQALQHVDGYQREEGTH-HMY 309 +H S + +V ++H+E +A H Y R + H H+Y Sbjct: 319 IHVSVFRRVLHQKHIEVEAYNHPHVYSRVKSNHPHVY 355 >SB_42304| Best HMM Match : NHL (HMM E-Value=0) Length = 1279 Score = 27.5 bits (58), Expect = 9.1 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 542 LVRRCRRRQHHSLPSSNPMD 601 LV+R QHH+LPS +P D Sbjct: 1192 LVKRIAGMQHHNLPSPHPED 1211 >SB_6486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 27.5 bits (58), Expect = 9.1 Identities = 18/46 (39%), Positives = 23/46 (50%) Frame = -2 Query: 312 VRSXLRAFLPRSVLCGIMPLQSSIES*MEL*NGKVHEQDSRCTSYA 175 + S AF+P+S C PLQS + L KVH+Q CT A Sbjct: 102 LNSNAPAFIPQSPSCSASPLQSGAQMLKSL--VKVHDQS--CTGKA 143 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,873,021 Number of Sequences: 59808 Number of extensions: 399795 Number of successful extensions: 1567 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1499 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1566 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1512078125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -