BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30416 (688 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L12018-5|AAU87822.1| 557|Caenorhabditis elegans Twik family of ... 30 1.8 AL023858-1|CAA19568.2| 328|Caenorhabditis elegans Hypothetical ... 28 5.4 >L12018-5|AAU87822.1| 557|Caenorhabditis elegans Twik family of potassium channelsprotein 7 protein. Length = 557 Score = 29.9 bits (64), Expect = 1.8 Identities = 17/50 (34%), Positives = 23/50 (46%) Frame = +3 Query: 126 RNLHIFLNQINDKYSQNLLVGK*VASFNNKYINYYYKRVVNCCKCTFVVE 275 R +H F +I D S +VG V + Y N KR N + F+VE Sbjct: 451 RKIHYFGRKIQDARSALAVVGGKVVLVSELYANLMQKRARNMSREAFIVE 500 >AL023858-1|CAA19568.2| 328|Caenorhabditis elegans Hypothetical protein ZK285.1 protein. Length = 328 Score = 28.3 bits (60), Expect = 5.4 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +1 Query: 547 YSYSKSVFALTFXYFYIECXIIVMHKXINGRK 642 Y +S S+FA F Y Y I K I+G+K Sbjct: 96 YGFSMSIFACHFIYRYGNVNTIFKQKYISGKK 127 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,386,311 Number of Sequences: 27780 Number of extensions: 220892 Number of successful extensions: 386 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 378 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 386 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1571291122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -