BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30416 (688 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g11130.1 68418.m01300 exostosin family protein contains Pfam ... 27 8.8 At5g03800.1 68418.m00347 exostosin family protein / pentatricope... 27 8.8 >At5g11130.1 68418.m01300 exostosin family protein contains Pfam profile: PF03016 Exostosin family Length = 336 Score = 27.5 bits (58), Expect = 8.8 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +3 Query: 351 FNVCVRVIKCFSYISFFSLAKNKRTFNVKFDIEKIPSL 464 ++ CV VI Y+ FS N +TF+V I K+P + Sbjct: 241 YSGCVPVIIADYYVLPFSDVLNWKTFSVHIPISKMPDI 278 >At5g03800.1 68418.m00347 exostosin family protein / pentatricopeptide (PPR) repeat-containing protein contains Pfam profiles: PF03016 exostosin family, PF01535 PPR repeat Length = 1388 Score = 27.5 bits (58), Expect = 8.8 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +3 Query: 351 FNVCVRVIKCFSYISFFSLAKNKRTFNVKFDIEKIPSL 464 ++ CV V+ Y+ FS N R+F+V +E IP+L Sbjct: 1294 YSGCVPVLINSGYVPPFSDVLNWRSFSVIVSVEDIPNL 1331 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,971,784 Number of Sequences: 28952 Number of extensions: 181094 Number of successful extensions: 241 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 239 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 241 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1457719448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -