BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30415 (684 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0694 - 5719188-5720400,5720439-5721194,5722004-5722247,572... 29 4.5 05_01_0103 + 686770-687017,687120-687270 28 7.9 >11_01_0694 - 5719188-5720400,5720439-5721194,5722004-5722247, 5723862-5723901 Length = 750 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -1 Query: 564 NLPLLNHTLLPEFL-LPPISTLRGVNRILTIRIRKLVGVNILRI 436 NLPLL H +L EFL L + ++ +I++ + +N L + Sbjct: 263 NLPLLEHAILDEFLELSRLENVKSTQEARSIKLIEKESINSLNL 306 >05_01_0103 + 686770-687017,687120-687270 Length = 132 Score = 27.9 bits (59), Expect = 7.9 Identities = 20/72 (27%), Positives = 34/72 (47%) Frame = -1 Query: 459 VGVNILRISKASFSLPLKDYKNKKRTPVFTLLYL*THSNQQIQKIYIISWSVYWLSTKTK 280 VG +L + SLP N+ R +F ++ T N Q KI+ I+WS ++K Sbjct: 39 VGEPVLNYDDFAASLPA----NECRYAIFDYDFV-TEENCQKSKIFFIAWSPDTSRVRSK 93 Query: 279 ITFMTHHKKLKR 244 + + + + KR Sbjct: 94 MIYASSKDRFKR 105 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,271,253 Number of Sequences: 37544 Number of extensions: 245372 Number of successful extensions: 367 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 361 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 367 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1733104716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -