BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30415 (684 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g32030.2 68417.m04559 expressed protein 29 3.8 >At4g32030.2 68417.m04559 expressed protein Length = 204 Score = 28.7 bits (61), Expect = 3.8 Identities = 22/63 (34%), Positives = 28/63 (44%), Gaps = 3/63 (4%) Frame = +1 Query: 73 NGFRVLLQSILAECFLSRLFGRTSACE*YN---FKLKGRLILLILDFHC*VFFIILTLHI 243 +G +V + + CF RL R S+ E N KLK RL L +DF C F H Sbjct: 125 SGSKVFPTNEITSCFSKRLKKRKSSFELKNEENLKLKERLDLEKVDFRCYSLFYYHGFHC 184 Query: 244 PFK 252 K Sbjct: 185 ILK 187 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,374,404 Number of Sequences: 28952 Number of extensions: 227691 Number of successful extensions: 324 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 320 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 324 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -