BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30412 (515 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC11C11.08 |srp1||SR family protein Srp1|Schizosaccharomyces p... 28 0.72 SPCC594.01 ||SPCC736.16|DUF1769 family protein|Schizosaccharomyc... 27 2.2 SPAC17A2.06c |vps8||WD repeat protein Vps8|Schizosaccharomyces p... 26 2.9 SPBC21C3.18 |spo4||serine/threonine protein kinase Spo4|Schizosa... 25 6.7 SPAC22A12.09c |sap114||splicing factor Sap114|Schizosaccharomyce... 25 8.9 >SPBC11C11.08 |srp1||SR family protein Srp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 275 Score = 28.3 bits (60), Expect = 0.72 Identities = 21/51 (41%), Positives = 24/51 (47%) Frame = -3 Query: 429 GWSGRWPDRSPRSHQGRARHTVAARIRLHSDSDPRSYRRRARNSWTGRSTS 277 G SGR RSP H+ R+R PR YR R+R S GRS S Sbjct: 108 GDSGRLRSRSPSPHEARSRSPYNDERSDRRSMSPR-YRSRSR-SPDGRSRS 156 >SPCC594.01 ||SPCC736.16|DUF1769 family protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 791 Score = 26.6 bits (56), Expect = 2.2 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +1 Query: 310 TASVTPRVTVTVKPDSRRHCVPCPALVA 393 T VTP +TVT PDS PA VA Sbjct: 200 TNIVTPPITVTAVPDSPNPPAATPATVA 227 >SPAC17A2.06c |vps8||WD repeat protein Vps8|Schizosaccharomyces pombe|chr 1|||Manual Length = 1272 Score = 26.2 bits (55), Expect = 2.9 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +3 Query: 60 SWSSAWTRWRPSRRCSSTI 116 SW+ W RW RR SS + Sbjct: 64 SWNDCWMRWGQLRRVSSQL 82 >SPBC21C3.18 |spo4||serine/threonine protein kinase Spo4|Schizosaccharomyces pombe|chr 2|||Manual Length = 429 Score = 25.0 bits (52), Expect = 6.7 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 137 RTAIIDLGLGXWIPASCPTE 196 R I+D GL W A PTE Sbjct: 196 RGVILDFGLAQWQEADAPTE 215 >SPAC22A12.09c |sap114||splicing factor Sap114|Schizosaccharomyces pombe|chr 1|||Manual Length = 481 Score = 24.6 bits (51), Expect = 8.9 Identities = 10/42 (23%), Positives = 16/42 (38%) Frame = +1 Query: 310 TASVTPRVTVTVKPDSRRHCVPCPALVAPWTPVRPPTRPSKG 435 TA++ + + PD P PW P+ P + G Sbjct: 289 TATLEQKSAMFTMPDQNYTIEEAPPTAEPWEPISAPKKQEFG 330 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,125,774 Number of Sequences: 5004 Number of extensions: 41734 Number of successful extensions: 118 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 118 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -