BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30412 (515 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. 29 0.12 AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. 29 0.12 AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. 29 0.12 AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. 29 0.12 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 29 0.12 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 27 0.38 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 25 1.5 AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein p... 25 1.5 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 25 2.0 AY604021-1|AAT38515.1| 118|Anopheles gambiae LZ9988P protein. 24 2.6 AY146735-1|AAO12095.1| 149|Anopheles gambiae odorant-binding pr... 24 2.6 DQ370035-1|ABD18596.1| 93|Anopheles gambiae defensin protein. 23 4.6 AY973195-1|AAY41589.1| 80|Anopheles gambiae defensin 2 protein. 23 4.6 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 4.6 EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calc... 23 6.1 AY907825-1|AAX92637.1| 67|Anopheles gambiae antimicrobial pept... 23 6.1 M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 23 8.1 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 8.1 AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CY... 23 8.1 >AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 28.7 bits (61), Expect = 0.12 Identities = 13/22 (59%), Positives = 14/22 (63%), Gaps = 3/22 (13%) Frame = +3 Query: 291 PSN---CSGHGVCNSEGHCHCE 347 PSN CSGHG CN G C C+ Sbjct: 30 PSNDAVCSGHGQCNC-GRCSCD 50 >AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 28.7 bits (61), Expect = 0.12 Identities = 13/22 (59%), Positives = 14/22 (63%), Gaps = 3/22 (13%) Frame = +3 Query: 291 PSN---CSGHGVCNSEGHCHCE 347 PSN CSGHG CN G C C+ Sbjct: 30 PSNDAVCSGHGQCNC-GRCSCD 50 >AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 28.7 bits (61), Expect = 0.12 Identities = 13/22 (59%), Positives = 14/22 (63%), Gaps = 3/22 (13%) Frame = +3 Query: 291 PSN---CSGHGVCNSEGHCHCE 347 PSN CSGHG CN G C C+ Sbjct: 30 PSNDAVCSGHGQCNC-GRCSCD 50 >AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 28.7 bits (61), Expect = 0.12 Identities = 13/22 (59%), Positives = 14/22 (63%), Gaps = 3/22 (13%) Frame = +3 Query: 291 PSN---CSGHGVCNSEGHCHCE 347 PSN CSGHG CN G C C+ Sbjct: 30 PSNDAVCSGHGQCNC-GRCSCD 50 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 28.7 bits (61), Expect = 0.12 Identities = 13/22 (59%), Positives = 14/22 (63%), Gaps = 3/22 (13%) Frame = +3 Query: 291 PSN---CSGHGVCNSEGHCHCE 347 PSN CSGHG CN G C C+ Sbjct: 606 PSNDAVCSGHGQCNC-GRCSCD 626 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 27.1 bits (57), Expect = 0.38 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = +2 Query: 44 RHLNEKLEFGMDSVAAVSAVFINNNGTIIPCRTAIIDLGLGXWIPASCP 190 R E+ E M AAV A +N N + R ++ G G W+P P Sbjct: 331 REPTEREEQQMQKEAAVMARTMNLNQVCLCFRAYRVEPGTGRWVPICEP 379 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 25.0 bits (52), Expect = 1.5 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +3 Query: 300 CSGHGVCNSEGHCHC 344 CSGHG C G C C Sbjct: 645 CSGHGTCEC-GTCRC 658 >AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein protein. Length = 499 Score = 25.0 bits (52), Expect = 1.5 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = -3 Query: 300 SWTGRSTSXC*LSSPDGLNGHAPLFQAHLVLPAGGSVGHEAGIXSPSPKS 151 ++T R+ L SPDG+NG+ L L A +G G S +P+S Sbjct: 15 AYTQRTKCAACLDSPDGMNGNESLHPRPLG-SALKDIGAFFGRSSKTPRS 63 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 24.6 bits (51), Expect = 2.0 Identities = 13/39 (33%), Positives = 16/39 (41%) Frame = -2 Query: 421 GSVAGPESTEPPGPGKAHSGGANPASQ*Q*PSELQTPCP 305 G + GP + PP P GGA P P + P P Sbjct: 601 GPLGGPAGSRPPLPNLLGFGGAAPPVTILVPYPIIIPLP 639 >AY604021-1|AAT38515.1| 118|Anopheles gambiae LZ9988P protein. Length = 118 Score = 24.2 bits (50), Expect = 2.6 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = +2 Query: 74 MDSVAAVSAVFINNNGTIIPC 136 +DS+AA+SA ++ NG+ I C Sbjct: 29 LDSLAALSAKELDTNGSKIKC 49 >AY146735-1|AAO12095.1| 149|Anopheles gambiae odorant-binding protein AgamOBP25 protein. Length = 149 Score = 24.2 bits (50), Expect = 2.6 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = +2 Query: 74 MDSVAAVSAVFINNNGTIIPC 136 +DS+AA+SA ++ NG+ I C Sbjct: 53 LDSLAALSAKELDTNGSKIKC 73 >DQ370035-1|ABD18596.1| 93|Anopheles gambiae defensin protein. Length = 93 Score = 23.4 bits (48), Expect = 4.6 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 312 GVCNSEGHCHC 344 G CNSEG C C Sbjct: 67 GYCNSEGLCTC 77 >AY973195-1|AAY41589.1| 80|Anopheles gambiae defensin 2 protein. Length = 80 Score = 23.4 bits (48), Expect = 4.6 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 312 GVCNSEGHCHC 344 G CNSEG C C Sbjct: 54 GYCNSEGLCTC 64 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.4 bits (48), Expect = 4.6 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = +3 Query: 285 ICPSNCSGHGVCNSE 329 +CP C G G+ +S+ Sbjct: 297 VCPKTCPGEGIVHSD 311 >EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calcium channel beta subunitprotein. Length = 466 Score = 23.0 bits (47), Expect = 6.1 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 215 LCSPQAAPSGTRPGSXLPVP 156 L S +A+PSG +PG P P Sbjct: 438 LPSQEASPSGEQPGRMGPPP 457 >AY907825-1|AAX92637.1| 67|Anopheles gambiae antimicrobial peptide defensin 3 protein. Length = 67 Score = 23.0 bits (47), Expect = 6.1 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = +3 Query: 279 SSICPSNCSGHGVCNSEGHCHC 344 +++C + G G CN++ C C Sbjct: 43 AAVCHMSGRGAGSCNAKDECVC 64 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 22.6 bits (46), Expect = 8.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +3 Query: 312 GVCNSEGHCHC 344 GVC S+ H HC Sbjct: 54 GVCGSKHHTHC 64 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 22.6 bits (46), Expect = 8.1 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = +3 Query: 318 CNSEGHCHCE 347 CN+EG C C+ Sbjct: 409 CNAEGRCQCK 418 >AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CYP6P2 protein. Length = 507 Score = 22.6 bits (46), Expect = 8.1 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +1 Query: 298 TVPGTASVTPRVTVTVKP 351 TVPGTA V P+ T+ P Sbjct: 390 TVPGTAHVIPKGTMIQIP 407 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 576,830 Number of Sequences: 2352 Number of extensions: 12438 Number of successful extensions: 58 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 50 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 53 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -