BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30411 (538 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 22 3.5 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 3.5 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 3.5 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 4.6 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 21 8.0 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.2 bits (45), Expect = 3.5 Identities = 11/46 (23%), Positives = 20/46 (43%) Frame = +2 Query: 218 RSASDQRRSEGGQDLHVAGDSELYRVLNLHYNRNNHIEVPSNFRYV 355 RS + R + ++ S N +YN NN+ ++ N Y+ Sbjct: 288 RSRDRRERERSKEPKIISSLSNSCNYSNNYYNNNNYKKLYYNINYI 333 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 3.5 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 2 TDLPYDGVQPTSSTLTPMHLRKA 70 +D Y G TSS ++PM +K+ Sbjct: 1815 SDFIYHGTSSTSSDISPMSEQKS 1837 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 3.5 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 2 TDLPYDGVQPTSSTLTPMHLRKA 70 +D Y G TSS ++PM +K+ Sbjct: 1811 SDFIYHGTSSTSSDISPMSEQKS 1833 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 4.6 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 260 LHVAGDSELYRVLNLHYNRNN 322 +HV G+SE VL L ++ +N Sbjct: 1197 VHVPGESESETVLTLAWSESN 1217 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.0 bits (42), Expect = 8.0 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = -1 Query: 322 VISVVMQVEDSVKFRVTGNMQVLAAFRPSLIACRAYF 212 V ++Q E V + N L A + L AC +YF Sbjct: 25 VFHQLLQTEAFVDVTLACNEASLKAHKVVLSACSSYF 61 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,950 Number of Sequences: 438 Number of extensions: 2327 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15213684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -