BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30409 (372 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U53155-10|AAC48271.1| 346|Caenorhabditis elegans Seven tm recep... 26 7.5 AF078157-1|AAG24071.1| 235|Caenorhabditis elegans Hypothetical ... 26 7.5 >U53155-10|AAC48271.1| 346|Caenorhabditis elegans Seven tm receptor protein 139 protein. Length = 346 Score = 26.2 bits (55), Expect = 7.5 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -3 Query: 181 GVYSNRYFYVTTILAFFREREKRS*VLCFSHFV 83 G+ S Y + + A F +E R+ VLC HFV Sbjct: 285 GMLSGIYPAIEPVFAIFFVKEFRNFVLCKKHFV 317 >AF078157-1|AAG24071.1| 235|Caenorhabditis elegans Hypothetical protein F25E5.8a protein. Length = 235 Score = 26.2 bits (55), Expect = 7.5 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +2 Query: 50 VITHSNLKEHXNKMTKTKHSTSLLTFPEE 136 V++ S+LKE +K+ +T S S FPE+ Sbjct: 195 VVSSSSLKEKLHKIKRTTSSDSDTDFPEK 223 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,115,267 Number of Sequences: 27780 Number of extensions: 119384 Number of successful extensions: 210 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 183 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 210 length of database: 12,740,198 effective HSP length: 73 effective length of database: 10,712,258 effective search space used: 535612900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -