BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30408 (332 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY062199-1|AAL58560.1| 151|Anopheles gambiae cytochrome P450 CY... 25 0.75 AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 pr... 25 0.99 >AY062199-1|AAL58560.1| 151|Anopheles gambiae cytochrome P450 CYP4H19 protein. Length = 151 Score = 25.0 bits (52), Expect = 0.75 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +3 Query: 66 VPVTYRLNTKVNMANDPERFDSMLLAMAQQHEGGVKDLL 182 +P+ Y ++ + DPERFD + A QH G D + Sbjct: 102 IPI-YVIHRNPAVFPDPERFDPERFSGANQHPPGPYDYI 139 >AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 protein. Length = 505 Score = 24.6 bits (51), Expect = 0.99 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 66 VPVTYRLNTKVNMANDPERFDSMLLAMAQQH 158 +P+ Y ++ ++ DPERFD A+A H Sbjct: 404 IPI-YAIHHDASIYPDPERFDPDRFALAATH 433 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 276,159 Number of Sequences: 2352 Number of extensions: 4290 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 563,979 effective HSP length: 56 effective length of database: 432,267 effective search space used: 23342418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -