BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30405 (589 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 25 2.4 AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 25 2.4 AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 23 9.7 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 24.6 bits (51), Expect = 2.4 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +3 Query: 420 LYIHCCSCFNIFFASGNSDVLYVKAILR 503 L + C S ++FF+SG V+ + +LR Sbjct: 930 LLVVCVSLISMFFSSGAISVIKILRVLR 957 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 24.6 bits (51), Expect = 2.4 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = +1 Query: 82 QDGRNLLINLEKVNKMNWWGRLVTTDPEISTRKINPEPSKLSDLDGETRGLVEKM 246 QDG +LL+NL KVN RL+ + I T + S L E + + + Sbjct: 619 QDGTHLLMNLIKVNDPVVMNRLIDS-AAIDTILVTEHQSVAIQLTSEIENVPQNL 672 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 22.6 bits (46), Expect = 9.7 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +3 Query: 276 LPTSDEQKKQEVLKKFMEQH 335 L ++D K++E ++KF E+H Sbjct: 963 LQSADFAKRREAVEKFNEEH 982 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 572,563 Number of Sequences: 2352 Number of extensions: 10574 Number of successful extensions: 32 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56347938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -