BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30399 (467 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0358 - 24668212-24668475 29 1.9 09_04_0202 - 15544498-15545037,15546043-15546449,15546874-155469... 27 7.5 07_03_0506 - 18861787-18861917,18862017-18862201,18862542-188626... 27 10.0 >04_04_0358 - 24668212-24668475 Length = 87 Score = 29.1 bits (62), Expect = 1.9 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 127 LFVLLCCGIVVFGKQC-CPDGVIISPRGKCG-TEPMVSMNCSNGSCY 261 L +LL + C C DG S G CG TE C +G C+ Sbjct: 11 LALLLSAAAPAAAQNCGCQDGYCCSQWGYCGTTEAYCGQGCQSGPCW 57 >09_04_0202 - 15544498-15545037,15546043-15546449,15546874-15546977, 15547580-15547788,15548092-15549428,15551680-15551941 Length = 952 Score = 27.1 bits (57), Expect = 7.5 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 228 GQHELQQWKLLLKDIILNGNKVSTQDTPD 314 G H+ K LL+D+ N +K+ DTPD Sbjct: 695 GYHDGSFVKNLLEDLNFNTSKIKAYDTPD 723 >07_03_0506 - 18861787-18861917,18862017-18862201,18862542-18862613, 18863163-18863234,18863596-18863667,18864371-18864518, 18864864-18865922,18866663-18866762 Length = 612 Score = 26.6 bits (56), Expect = 10.0 Identities = 15/50 (30%), Positives = 21/50 (42%) Frame = -3 Query: 375 LYRFCTWHRDNTHQDLRRKQNLECPE*TPYFHSRLYLSIATSIAAVHADH 226 ++ C W R Q++RR Q L PY SR + +A H H Sbjct: 549 VFAACWWKR---RQNIRRAQKLAAAREAPYAKSRTQFTRDMQMAKHHRPH 595 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,368,853 Number of Sequences: 37544 Number of extensions: 247836 Number of successful extensions: 625 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 625 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 943260316 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -