BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30398 (520 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF164152-1|AAD47076.1| 261|Anopheles gambiae ribosomal protein ... 281 8e-78 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 25 2.0 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 25 2.0 >AF164152-1|AAD47076.1| 261|Anopheles gambiae ribosomal protein L8 protein. Length = 261 Score = 281 bits (690), Expect = 8e-78 Identities = 129/164 (78%), Positives = 147/164 (89%), Gaps = 1/164 (0%) Frame = +2 Query: 23 MGRVIRAQRKGAGSVFVSHTKKRKGAPKLRSLDYAERHGYIKGVVKDIIHDPGRGAPLAV 202 MGRVIRAQRKGAGSVF +HTKKRKG PKLR LDYAERHGY+KGVVK II DPGRGAPLAV Sbjct: 1 MGRVIRAQRKGAGSVFRAHTKKRKGQPKLRHLDYAERHGYLKGVVKQIIQDPGRGAPLAV 60 Query: 203 VHFRDPYKFKTRKELFIVPK-LYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKX 379 V+FRDPY+F+ K+LFI + +YTGQFVYCG++A L++GNV+P+G MPEGTIVCNLEEK Sbjct: 61 VNFRDPYRFRLSKQLFIAAEGMYTGQFVYCGRRAQLQIGNVIPIGLMPEGTIVCNLEEKT 120 Query: 380 XDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPSSNRA 511 DRG+LAR SGN+A+VI HNPD KRTRVKLPSGAKKVLPS+NRA Sbjct: 121 GDRGKLARTSGNYASVIAHNPDTKRTRVKLPSGAKKVLPSANRA 164 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 24.6 bits (51), Expect = 2.0 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +2 Query: 131 RHGYIKGVVKDIIHDP 178 R+ +K ++KDI+HDP Sbjct: 737 RYTMLKDMIKDIMHDP 752 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 24.6 bits (51), Expect = 2.0 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +2 Query: 131 RHGYIKGVVKDIIHDP 178 R+ +K ++KDI+HDP Sbjct: 737 RYTMLKDMIKDIMHDP 752 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 557,760 Number of Sequences: 2352 Number of extensions: 11686 Number of successful extensions: 22 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47360208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -