BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30395 (436 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 1.5 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 1.5 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 23 2.0 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 21 7.9 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.0 bits (47), Expect = 1.5 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -1 Query: 283 ALRHQRRETGDAKSRPTSHSQYN 215 ALR + R GD RP SQ N Sbjct: 1632 ALRWRSRYLGDRMQRPMKESQEN 1654 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.0 bits (47), Expect = 1.5 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -1 Query: 283 ALRHQRRETGDAKSRPTSHSQYN 215 ALR + R GD RP SQ N Sbjct: 1628 ALRWRSRYLGDRMQRPMKESQEN 1650 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 22.6 bits (46), Expect = 2.0 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -1 Query: 244 SRPTSHSQYNPSLLYFSLK*RHP*NVMFR 158 S SH++Y+ L+YF L+ RH N + + Sbjct: 192 STTLSHAEYSMLLVYFHLQ-RHMGNFLIQ 219 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 20.6 bits (41), Expect = 7.9 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -1 Query: 322 AVVAPYSDVSSGRALRHQRRETGDAKSRPTSHSQY 218 A V S VSS + RHQR + T+H+++ Sbjct: 383 AAVQSSSIVSSPDSARHQRIGGCNGLHTTTAHNRF 417 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,256 Number of Sequences: 438 Number of extensions: 2835 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 11368164 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -