BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30394 (459 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19572| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_22177| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=4.5e-11) 28 3.2 SB_38061| Best HMM Match : DUF995 (HMM E-Value=4) 27 5.6 SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_41411| Best HMM Match : RVT_1 (HMM E-Value=0.00044) 27 7.5 SB_8056| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_53665| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_48079| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_37101| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_18811| Best HMM Match : RVT_1 (HMM E-Value=0.075) 27 7.5 SB_41973| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_6304| Best HMM Match : RVT_1 (HMM E-Value=3.2e-18) 27 9.9 >SB_19572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 823 Score = 29.9 bits (64), Expect = 1.1 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = -2 Query: 263 SASGIASRPSSQTFRARCVQPPRCPRGRAAPT 168 S+SG+ SR S T RAR PP P+ A+P+ Sbjct: 516 SSSGVPSRVGSATSRARQQPPPPPPQRPASPS 547 >SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3261 Score = 28.7 bits (61), Expect = 2.4 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +2 Query: 377 CEINEHGDAMCNCIKDCPYE 436 CE+ ++ +A+C C KDCP E Sbjct: 1779 CEVKDN-EAVCECPKDCPKE 1797 >SB_22177| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=4.5e-11) Length = 1170 Score = 28.3 bits (60), Expect = 3.2 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +3 Query: 357 LQRRNVSAKSTNTETPCVTASRTVPTRQ 440 L+R ++ + + + PC+TASR P+RQ Sbjct: 940 LRRAEMNYEQKHPKAPCLTASRPPPSRQ 967 >SB_38061| Best HMM Match : DUF995 (HMM E-Value=4) Length = 220 Score = 27.5 bits (58), Expect = 5.6 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +2 Query: 170 SEQLGRGDISEAEHIEHGMSESLDEKRYLRQK*PELTTFSTRSLMKRMKTKK 325 S G +++E EH E SE D+K + K + + R L KR++ KK Sbjct: 115 SSDSGNSEVTEQEHDEDANSEENDDKPTRKTKLDK----AQRKLNKRLRQKK 162 >SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 336 Score = 27.5 bits (58), Expect = 5.6 Identities = 20/63 (31%), Positives = 26/63 (41%) Frame = +1 Query: 1 GFRRDCRLLHIETHHRKAR*RVFLRWPS*SRSFAPPTLVYAA*APQDPHHDY*TSNVGAA 180 G+R R H HHR++R R R P R P + +P PHH S + Sbjct: 205 GYRDQRRRSHSPAHHRRSRSRSRSRSPRRRRRSRSPRRRRRSRSP-SPHHRSHRSRSRSR 263 Query: 181 RPR 189 PR Sbjct: 264 SPR 266 >SB_41411| Best HMM Match : RVT_1 (HMM E-Value=0.00044) Length = 647 Score = 27.1 bits (57), Expect = 7.5 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = -1 Query: 321 FVFILFIRDLVEKVVNSGYFCLRYRFSSKLSDI 223 F+F+L + ++ + V G +R++F+SKL D+ Sbjct: 468 FMFLLVMDWILRRSVGKGENGIRWKFTSKLGDL 500 >SB_8056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 27.1 bits (57), Expect = 7.5 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = -1 Query: 321 FVFILFIRDLVEKVVNSGYFCLRYRFSSKLSDI 223 F+F+L + ++ + V G +R++F+SKL D+ Sbjct: 67 FMFLLVMDWILRRSVGKGENGIRWKFTSKLDDL 99 >SB_53665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 27.1 bits (57), Expect = 7.5 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -3 Query: 196 DVPAAELLRRWTFSSRGADPAVPTP 122 +V AE LRRWT + G+ A P P Sbjct: 8 NVAVAEWLRRWTRNPMGSSRAGPNP 32 >SB_48079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 27.1 bits (57), Expect = 7.5 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = -1 Query: 321 FVFILFIRDLVEKVVNSGYFCLRYRFSSKLSDI 223 F+F+L + ++ + V G +R++F+SKL D+ Sbjct: 49 FMFLLVMDWILRRSVGKGENGIRWKFTSKLDDL 81 >SB_37101| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 27.1 bits (57), Expect = 7.5 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = -1 Query: 321 FVFILFIRDLVEKVVNSGYFCLRYRFSSKLSDI 223 F+F+L + ++ + V G +R++F+SKL D+ Sbjct: 11 FMFLLVMDWILRRSVGKGENGIRWKFTSKLDDL 43 >SB_18811| Best HMM Match : RVT_1 (HMM E-Value=0.075) Length = 203 Score = 27.1 bits (57), Expect = 7.5 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = -1 Query: 321 FVFILFIRDLVEKVVNSGYFCLRYRFSSKLSDI 223 F+F+L + ++ + V G +R++F+SKL D+ Sbjct: 95 FMFLLVMDWILRRSVGKGENGIRWKFTSKLDDL 127 >SB_41973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2504 Score = 26.6 bits (56), Expect = 9.9 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +3 Query: 342 LPESPLQRRNVSAKSTNTETPCVTASRTVPTRQ 440 LP SPL++ ++AKST P + + Q Sbjct: 875 LPSSPLKKITITAKSTTVAKPLLAPGHDISQMQ 907 >SB_6304| Best HMM Match : RVT_1 (HMM E-Value=3.2e-18) Length = 404 Score = 26.6 bits (56), Expect = 9.9 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = -1 Query: 321 FVFILFIRDLVEKVVNSGYFCLRYRFSSKLSDI 223 F+F+L + ++ + V G +R++F+SKL D+ Sbjct: 306 FMFLLVMDWVLRRSVGKGENGIRWKFTSKLDDL 338 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,299,470 Number of Sequences: 59808 Number of extensions: 221874 Number of successful extensions: 867 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 745 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 867 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 932979724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -