BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30390 (443 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ297931-1|CAC35451.1| 166|Anopheles gambiae hypothetical prote... 25 0.91 AF457546-1|AAL68776.1| 182|Anopheles gambiae 30 kDa protein pro... 23 3.7 AF387857-1|AAL58707.1| 215|Anopheles gambiae integrase protein. 23 4.9 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 23 6.4 >AJ297931-1|CAC35451.1| 166|Anopheles gambiae hypothetical protein protein. Length = 166 Score = 25.4 bits (53), Expect = 0.91 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = +2 Query: 113 DEEYETDPEPKVKGPKPTKEGSEDSDGSFNPSGSEEADSDFDPEAGEA 256 DE E PEP + P +E E+ + EEAD E+ E+ Sbjct: 59 DELPEDAPEPVPEDGSPDEEHLEEEQEEEAEADEEEADESESEESEES 106 >AF457546-1|AAL68776.1| 182|Anopheles gambiae 30 kDa protein protein. Length = 182 Score = 23.4 bits (48), Expect = 3.7 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +2 Query: 167 KEGSEDSDGSFNPSGSEEADSDFDPEAGEA 256 + +E SD + G+E+A SD + +AG A Sbjct: 55 ESSTELSDDAGAEEGAEDAGSDAEADAGAA 84 >AF387857-1|AAL58707.1| 215|Anopheles gambiae integrase protein. Length = 215 Score = 23.0 bits (47), Expect = 4.9 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +2 Query: 182 DSDGSFNPSGSEEADSDFDPEAGE 253 D D F+ + DSDFD + G+ Sbjct: 93 DDDLPFDDDSDFDDDSDFDDDVGD 116 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 22.6 bits (46), Expect = 6.4 Identities = 12/39 (30%), Positives = 16/39 (41%) Frame = +2 Query: 149 KGPKPTKEGSEDSDGSFNPSGSEEADSDFDPEAGEASRK 265 K P+ ++ G DSD + E GE SRK Sbjct: 943 KKPRKSQGGGGSRKRKEKARRGSGGDSDSEEEEGEGSRK 981 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 245,539 Number of Sequences: 2352 Number of extensions: 3854 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 37418568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -