BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30381 (655 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI00015ADF81 Cluster: hypothetical protein NEMVEDRAFT_... 34 3.4 UniRef50_UPI000023D923 Cluster: predicted protein; n=1; Gibberel... 33 7.9 >UniRef50_UPI00015ADF81 Cluster: hypothetical protein NEMVEDRAFT_v1g225652; n=1; Nematostella vectensis|Rep: hypothetical protein NEMVEDRAFT_v1g225652 - Nematostella vectensis Length = 266 Score = 33.9 bits (74), Expect = 3.4 Identities = 19/64 (29%), Positives = 35/64 (54%) Frame = +1 Query: 49 INFRKFIGIFWTNFRYIYISFFCIVCYLVIVEHCFKKQ*NMIDEQYYDYI*WNTYIHIR* 228 I++ ++I I +T + +I + + + Y + H Q N ID Y++I + YIHI Sbjct: 47 IDYTQYIHIDYTQYNHIDYTQYIHIDYTQYI-HIDYTQYNHIDYTQYNHIDYTQYIHIDY 105 Query: 229 TRYV 240 T+Y+ Sbjct: 106 TQYI 109 >UniRef50_UPI000023D923 Cluster: predicted protein; n=1; Gibberella zeae PH-1|Rep: predicted protein - Gibberella zeae PH-1 Length = 770 Score = 32.7 bits (71), Expect = 7.9 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +2 Query: 173 LMNNIMTTYNGTHTYILDRLGMSNITLNHT 262 L NN++TTYNG H + RL T+N T Sbjct: 150 LENNVLTTYNGNHGDLQSRLSSIQQTINST 179 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 524,984,222 Number of Sequences: 1657284 Number of extensions: 9000425 Number of successful extensions: 14816 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14381 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14800 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 49173558301 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -