BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30381 (655 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81133-3|CAB03443.3| 527|Caenorhabditis elegans Hypothetical pr... 28 6.7 AC006673-10|AAP31433.1| 361|Caenorhabditis elegans Serpentine r... 27 8.8 >Z81133-3|CAB03443.3| 527|Caenorhabditis elegans Hypothetical protein T28B8.5 protein. Length = 527 Score = 27.9 bits (59), Expect = 6.7 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 67 IGIFWTNFRYIYISFFC 117 +G+FWT +Y++ F C Sbjct: 1 MGVFWTGLKYVFTDFSC 17 >AC006673-10|AAP31433.1| 361|Caenorhabditis elegans Serpentine receptor, class w protein89 protein. Length = 361 Score = 27.5 bits (58), Expect = 8.8 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = +1 Query: 1 LIYCYKLP**GCNLTIINFRKFIGIFWTNFRYIYISFFCIVCYLVIVEHCFKK 159 +IY YK G NLT +N + + +F + I S C++C+ + H ++K Sbjct: 283 IIYFYKAVWRG-NLTYLNLAENVKLFCHSLFTINASIHCLICF--SMSHQYRK 332 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,773,336 Number of Sequences: 27780 Number of extensions: 234567 Number of successful extensions: 419 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 412 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 419 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1455289764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -