BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30378 (1044 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_16924| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_32855| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_14019| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.008 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.008 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.008 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.008 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.008 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.008 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.008 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.008 SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) 39 0.008 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.008 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.008 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.008 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.008 SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.008 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.008 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 38 0.010 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_34396| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 38 0.013 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 38 0.018 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.018 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_2166| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_175| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) 37 0.023 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_45961| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_40987| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_8834| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_8733| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 37 0.031 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 37 0.031 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 37 0.031 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_28961| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 37 0.031 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 37 0.031 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 37 0.031 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_44850| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 37 0.031 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 37 0.031 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_32003| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 37 0.031 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 37 0.031 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 37 0.031 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 37 0.031 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.031 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 36 0.041 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_24515| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 36 0.041 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 36 0.041 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 36 0.041 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 36 0.041 SB_39848| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 36 0.041 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 36 0.041 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 36 0.041 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_9177| Best HMM Match : PPI_Ypi1 (HMM E-Value=1.9) 36 0.041 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_3957| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_379| Best HMM Match : ADK (HMM E-Value=3.2e-05) 36 0.041 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 36 0.054 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 36 0.054 SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 36 0.054 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 36 0.054 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 36 0.054 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 36 0.054 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_32799| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_30165| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_29965| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 36 0.054 SB_19538| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_18933| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_16339| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_15013| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_13185| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 36 0.054 SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 36 0.054 SB_3601| Best HMM Match : DUF765 (HMM E-Value=3.9) 36 0.054 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 36 0.054 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.054 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 36 0.071 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 36 0.071 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 36 0.071 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 36 0.071 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 36 0.071 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 36 0.071 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 36 0.071 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 36 0.071 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 36 0.071 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 36 0.071 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 36 0.071 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 36 0.071 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 36 0.071 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 36 0.071 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 36 0.071 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 36 0.071 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 36 0.071 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 36 0.071 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 36 0.071 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 36 0.071 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 36 0.071 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_9646| Best HMM Match : MrpF_PhaF (HMM E-Value=9.1) 36 0.071 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 36 0.071 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 36 0.071 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 36 0.071 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 36 0.071 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 36 0.071 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 36 0.071 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 36 0.071 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 36 0.071 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 42.3 bits (95), Expect = 6e-04 Identities = 19/33 (57%), Positives = 21/33 (63%) Frame = -2 Query: 119 RCH*LFVDIILPAHFDLVPNSCSPGDPLVLERP 21 RC L + F L+ NSCSPGDPLVLERP Sbjct: 8 RCGHLTTNAATRVRFPLISNSCSPGDPLVLERP 40 >SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 41.9 bits (94), Expect = 8e-04 Identities = 18/29 (62%), Positives = 23/29 (79%), Gaps = 1/29 (3%) Frame = -2 Query: 104 FVDIILPAHFDL-VPNSCSPGDPLVLERP 21 F D ++ A+ D+ + NSCSPGDPLVLERP Sbjct: 4 FTDTLISANIDIPLSNSCSPGDPLVLERP 32 >SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 41.9 bits (94), Expect = 8e-04 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ NSCSPGDPLVLERP Sbjct: 4 FTDTLISANISQTSNSCSPGDPLVLERP 31 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ NSCSPGDPLVLERP Sbjct: 4 FTDTLISANICFTSNSCSPGDPLVLERP 31 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 41.5 bits (93), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -2 Query: 107 LFVDIILPAHFDLVPNSCSPGDPLVLERP 21 +FV I DL+ NSCSPGDPLVLERP Sbjct: 25 VFVRDIRILFLDLISNSCSPGDPLVLERP 53 >SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ NSCSPGDPLVLERP Sbjct: 4 FTDTLISANIGKTSNSCSPGDPLVLERP 31 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ + NSCSPGDPLVLERP Sbjct: 4 FTDTLISANIVHISNSCSPGDPLVLERP 31 >SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ NSCSPGDPLVLERP Sbjct: 4 FTDTLISANIKFRSNSCSPGDPLVLERP 31 >SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/25 (76%), Positives = 21/25 (84%), Gaps = 1/25 (4%) Frame = -2 Query: 92 ILPAHFDLVP-NSCSPGDPLVLERP 21 +L A F+ VP NSCSPGDPLVLERP Sbjct: 37 VLSAVFETVPSNSCSPGDPLVLERP 61 >SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ NSCSPGDPLVLERP Sbjct: 4 FTDTLISANIKAGSNSCSPGDPLVLERP 31 >SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -2 Query: 89 LPAHFDLVPNSCSPGDPLVLERP 21 +P H+ NSCSPGDPLVLERP Sbjct: 104 IPDHYSSPSNSCSPGDPLVLERP 126 >SB_16924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ NSCSPGDPLVLERP Sbjct: 4 FTDTLISANIRNTSNSCSPGDPLVLERP 31 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 40.3 bits (90), Expect = 0.003 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ NSCSPGDPLVLERP Sbjct: 4 FTDTLISANIFFRSNSCSPGDPLVLERP 31 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 40.3 bits (90), Expect = 0.003 Identities = 17/28 (60%), Positives = 22/28 (78%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ ++ NSCSPGDPLVLERP Sbjct: 4 FTDTLISANI-IISNSCSPGDPLVLERP 30 >SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 40.3 bits (90), Expect = 0.003 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ NSCSPGDPLVLERP Sbjct: 4 FTDTLISANIPKRSNSCSPGDPLVLERP 31 >SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 40.3 bits (90), Expect = 0.003 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = -2 Query: 113 H*LFVDIILPAHFDLVPNSCSPGDPLVLERP 21 H +F A+F + NSCSPGDPLVLERP Sbjct: 21 HLMFWAACCLAYFGFLSNSCSPGDPLVLERP 51 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/28 (60%), Positives = 22/28 (78%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ ++ NSCSPGDPLVLERP Sbjct: 4 FTDTLISANI-VISNSCSPGDPLVLERP 30 >SB_32855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ NSCSPGDPLVLERP Sbjct: 4 FTDTLISANILHASNSCSPGDPLVLERP 31 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ V NSCSPGDPLVLERP Sbjct: 4 FTDTLISANIS-VSNSCSPGDPLVLERP 30 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ +V NSCSPGDPLVLERP Sbjct: 4 FTDTLISAN--IVSNSCSPGDPLVLERP 29 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/29 (62%), Positives = 22/29 (75%), Gaps = 1/29 (3%) Frame = -2 Query: 104 FVDIILPAHFD-LVPNSCSPGDPLVLERP 21 F D ++ A+ L+ NSCSPGDPLVLERP Sbjct: 4 FTDTLISANIVFLISNSCSPGDPLVLERP 32 >SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 80 HFDLVPNSCSPGDPLVLERP 21 HF L NSCSPGDPLVLERP Sbjct: 19 HFLLPSNSCSPGDPLVLERP 38 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = -2 Query: 95 IILPAHFDLVPNSCSPGDPLVLERP 21 ++ P L+ NSCSPGDPLVLERP Sbjct: 54 VLAPVSRTLLSNSCSPGDPLVLERP 78 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +2 Query: 23 AALELVDPPGCRNSAPDQ 76 AALELVDPPGCRNS PD+ Sbjct: 31 AALELVDPPGCRNSMPDR 48 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -2 Query: 89 LPAHFDLVPNSCSPGDPLVLERP 21 LP + V NSCSPGDPLVLERP Sbjct: 57 LPGNLRPVSNSCSPGDPLVLERP 79 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/28 (60%), Positives = 22/28 (78%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ ++ NSCSPGDPLVLERP Sbjct: 4 FTDTLISAN--IISNSCSPGDPLVLERP 29 >SB_14019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ NSCSPGDPLVLERP Sbjct: 4 FTDTLISANILAGSNSCSPGDPLVLERP 31 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/30 (63%), Positives = 21/30 (70%), Gaps = 6/30 (20%) Frame = -2 Query: 92 ILPAHFDLVP------NSCSPGDPLVLERP 21 I+ H D+VP NSCSPGDPLVLERP Sbjct: 13 IIAVHIDVVPFYCYVSNSCSPGDPLVLERP 42 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/28 (60%), Positives = 22/28 (78%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ ++ NSCSPGDPLVLERP Sbjct: 4 FTDTLISAN--IISNSCSPGDPLVLERP 29 >SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 39.1 bits (87), Expect = 0.006 Identities = 18/29 (62%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -2 Query: 104 FVDIILPAHFDLVP-NSCSPGDPLVLERP 21 F D ++ A+ P NSCSPGDPLVLERP Sbjct: 4 FTDTLISANITWRPSNSCSPGDPLVLERP 32 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 39.1 bits (87), Expect = 0.006 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 92 ILPAHFDLVPNSCSPGDPLVLERP 21 IL LV NSCSPGDPLVLERP Sbjct: 19 ILSPRARLVSNSCSPGDPLVLERP 42 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 39.1 bits (87), Expect = 0.006 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 74 DLVPNSCSPGDPLVLERP 21 D V NSCSPGDPLVLERP Sbjct: 15 DFVSNSCSPGDPLVLERP 32 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 38.7 bits (86), Expect = 0.008 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -2 Query: 77 FDLVPNSCSPGDPLVLERP 21 F ++ NSCSPGDPLVLERP Sbjct: 15 FRIISNSCSPGDPLVLERP 33 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.7 bits (86), Expect = 0.008 Identities = 17/28 (60%), Positives = 22/28 (78%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ ++ NSCSPGDPLVLERP Sbjct: 4 FTDTLISAN--ILSNSCSPGDPLVLERP 29 >SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 38.7 bits (86), Expect = 0.008 Identities = 17/21 (80%), Positives = 18/21 (85%), Gaps = 1/21 (4%) Frame = -2 Query: 80 HF-DLVPNSCSPGDPLVLERP 21 HF D + NSCSPGDPLVLERP Sbjct: 3 HFTDTLSNSCSPGDPLVLERP 23 >SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 38.7 bits (86), Expect = 0.008 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ L NSCSPGDPLVLERP Sbjct: 4 FTDTLISANIFL-SNSCSPGDPLVLERP 30 >SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 38.7 bits (86), Expect = 0.008 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 86 PAHFDLVPNSCSPGDPLVLERP 21 P H + NSCSPGDPLVLERP Sbjct: 6 PKHKKSLSNSCSPGDPLVLERP 27 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 38.7 bits (86), Expect = 0.008 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -2 Query: 92 ILPAHFDLVPNSCSPGDPLVLERP 21 +L + L+ NSCSPGDPLVLERP Sbjct: 47 LLYTYIPLLSNSCSPGDPLVLERP 70 >SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 38.7 bits (86), Expect = 0.008 Identities = 27/55 (49%), Positives = 32/55 (58%), Gaps = 3/55 (5%) Frame = -2 Query: 176 RLCPHIAIMTGNGSFCDT--SRC-H*LFVDIILPAHFDLVPNSCSPGDPLVLERP 21 RL P+ TG+ S + SR H LFV +L + NSCSPGDPLVLERP Sbjct: 3 RLRPYHLESTGSRSITEVKLSRARHFLFVIEVLTG----LSNSCSPGDPLVLERP 53 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 38.7 bits (86), Expect = 0.008 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 74 DLVPNSCSPGDPLVLERP 21 D V NSCSPGDPLVLERP Sbjct: 9 DAVSNSCSPGDPLVLERP 26 >SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) Length = 736 Score = 38.7 bits (86), Expect = 0.008 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -2 Query: 86 PAHFDLVPNSCSPGDPLVLERP 21 P HF + NSCSPGDPLVLERP Sbjct: 608 PVHF--LSNSCSPGDPLVLERP 627 >SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 38.7 bits (86), Expect = 0.008 Identities = 17/29 (58%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -2 Query: 104 FVDIILPAHFD-LVPNSCSPGDPLVLERP 21 F D ++ A+ + NSCSPGDPLVLERP Sbjct: 4 FTDTLISANIGPITSNSCSPGDPLVLERP 32 >SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 38.7 bits (86), Expect = 0.008 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -2 Query: 80 HFDLVPNSCSPGDPLVLERP 21 H L NSCSPGDPLVLERP Sbjct: 3 HVSLSSNSCSPGDPLVLERP 22 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 38.7 bits (86), Expect = 0.008 Identities = 17/21 (80%), Positives = 18/21 (85%), Gaps = 1/21 (4%) Frame = -2 Query: 80 HFD-LVPNSCSPGDPLVLERP 21 HF L+ NSCSPGDPLVLERP Sbjct: 66 HFPCLISNSCSPGDPLVLERP 86 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 38.7 bits (86), Expect = 0.008 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -2 Query: 92 ILPAHFDLVPNSCSPGDPLVLERP 21 ++P L NSCSPGDPLVLERP Sbjct: 4 LIPYFIMLASNSCSPGDPLVLERP 27 >SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 38.7 bits (86), Expect = 0.008 Identities = 17/29 (58%), Positives = 22/29 (75%), Gaps = 1/29 (3%) Frame = -2 Query: 104 FVDIILPAHF-DLVPNSCSPGDPLVLERP 21 F D ++ A+ ++ NSCSPGDPLVLERP Sbjct: 4 FTDTLISANITNISSNSCSPGDPLVLERP 32 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 38.7 bits (86), Expect = 0.008 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 86 PAHFDLVPNSCSPGDPLVLERP 21 P + V NSCSPGDPLVLERP Sbjct: 17 PKRVNAVSNSCSPGDPLVLERP 38 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 38.3 bits (85), Expect = 0.010 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 LV NSCSPGDPLVLERP Sbjct: 24 LVSNSCSPGDPLVLERP 40 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.3 bits (85), Expect = 0.010 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ + NSCSPGDPLVLERP Sbjct: 4 FTDTLISAN--IASNSCSPGDPLVLERP 29 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 38.3 bits (85), Expect = 0.010 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 74 DLVPNSCSPGDPLVLERP 21 D V NSCSPGDPLVLERP Sbjct: 5 DRVSNSCSPGDPLVLERP 22 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.3 bits (85), Expect = 0.010 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 LV NSCSPGDPLVLERP Sbjct: 3 LVSNSCSPGDPLVLERP 19 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 38.3 bits (85), Expect = 0.010 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 LV NSCSPGDPLVLERP Sbjct: 17 LVSNSCSPGDPLVLERP 33 >SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 38.3 bits (85), Expect = 0.010 Identities = 18/31 (58%), Positives = 22/31 (70%), Gaps = 3/31 (9%) Frame = -2 Query: 104 FVDIILPAHFDLVP---NSCSPGDPLVLERP 21 F D ++ A+ L+ NSCSPGDPLVLERP Sbjct: 4 FTDTLISANIILIKITSNSCSPGDPLVLERP 34 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 38.3 bits (85), Expect = 0.010 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 LV NSCSPGDPLVLERP Sbjct: 9 LVSNSCSPGDPLVLERP 25 >SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 38.3 bits (85), Expect = 0.010 Identities = 18/24 (75%), Positives = 19/24 (79%), Gaps = 2/24 (8%) Frame = -2 Query: 86 PAHFDLV--PNSCSPGDPLVLERP 21 P + DLV NSCSPGDPLVLERP Sbjct: 179 PCYTDLVIQSNSCSPGDPLVLERP 202 >SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.3 bits (85), Expect = 0.010 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ + NSCSPGDPLVLERP Sbjct: 4 FTDTLISAN--ITSNSCSPGDPLVLERP 29 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 38.3 bits (85), Expect = 0.010 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +2 Query: 23 AALELVDPPGCRNSAPDQNE 82 AALELVDPPGCRNS D+ E Sbjct: 11 AALELVDPPGCRNSIKDKGE 30 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 38.3 bits (85), Expect = 0.010 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 LV NSCSPGDPLVLERP Sbjct: 5 LVSNSCSPGDPLVLERP 21 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.3 bits (85), Expect = 0.010 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 LV NSCSPGDPLVLERP Sbjct: 2 LVSNSCSPGDPLVLERP 18 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 38.3 bits (85), Expect = 0.010 Identities = 20/34 (58%), Positives = 24/34 (70%) Frame = -2 Query: 122 SRCH*LFVDIILPAHFDLVPNSCSPGDPLVLERP 21 ++C+ L V I+ P V NSCSPGDPLVLERP Sbjct: 14 TKCNRLGV-IVKPEGNKDVSNSCSPGDPLVLERP 46 >SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 74 DLVPNSCSPGDPLVLERP 21 D+ NSCSPGDPLVLERP Sbjct: 45 DIASNSCSPGDPLVLERP 62 >SB_34396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 38.3 bits (85), Expect = 0.010 Identities = 18/29 (62%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -2 Query: 104 FVDIILPAHFDLV-PNSCSPGDPLVLERP 21 F D ++ A+ V NSCSPGDPLVLERP Sbjct: 4 FTDTLISANIGEVGSNSCSPGDPLVLERP 32 >SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.3 bits (85), Expect = 0.010 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ + NSCSPGDPLVLERP Sbjct: 4 FTDTLISANI-ISSNSCSPGDPLVLERP 30 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 38.3 bits (85), Expect = 0.010 Identities = 18/26 (69%), Positives = 19/26 (73%), Gaps = 4/26 (15%) Frame = -2 Query: 86 PAHF----DLVPNSCSPGDPLVLERP 21 PAH +L NSCSPGDPLVLERP Sbjct: 2 PAHILCTQELTSNSCSPGDPLVLERP 27 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 38.3 bits (85), Expect = 0.010 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 LV NSCSPGDPLVLERP Sbjct: 26 LVSNSCSPGDPLVLERP 42 >SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 74 DLVPNSCSPGDPLVLERP 21 D+ NSCSPGDPLVLERP Sbjct: 19 DIASNSCSPGDPLVLERP 36 >SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = -2 Query: 95 IILPAHFDLVPNSCSPGDPLVLERP 21 +++P + NSCSPGDPLVLERP Sbjct: 26 LVVPKQESIRSNSCSPGDPLVLERP 50 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.9 bits (84), Expect = 0.013 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L+ NSCSPGDPLVLERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.9 bits (84), Expect = 0.013 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L+ NSCSPGDPLVLERP Sbjct: 17 LISNSCSPGDPLVLERP 33 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 37.9 bits (84), Expect = 0.013 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -2 Query: 80 HFDLVPNSCSPGDPLVLERP 21 HF NSCSPGDPLVLERP Sbjct: 137 HFAPSSNSCSPGDPLVLERP 156 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 37.9 bits (84), Expect = 0.013 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -2 Query: 74 DLVPNSCSPGDPLVLERP 21 +++ NSCSPGDPLVLERP Sbjct: 118 EIISNSCSPGDPLVLERP 135 >SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 37.9 bits (84), Expect = 0.013 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -2 Query: 83 AHFDLVPNSCSPGDPLVLERP 21 AH + NSCSPGDPLVLERP Sbjct: 51 AHCRVPSNSCSPGDPLVLERP 71 >SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 37.9 bits (84), Expect = 0.013 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ + NSCSPGDPLVLERP Sbjct: 4 FTDTLISANINS-SNSCSPGDPLVLERP 30 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 37.9 bits (84), Expect = 0.013 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L+ NSCSPGDPLVLERP Sbjct: 8 LISNSCSPGDPLVLERP 24 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.9 bits (84), Expect = 0.013 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 74 DLVPNSCSPGDPLVLERP 21 D V NSCSPGDPLVLERP Sbjct: 1 DPVSNSCSPGDPLVLERP 18 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.9 bits (84), Expect = 0.013 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L+ NSCSPGDPLVLERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 37.9 bits (84), Expect = 0.013 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 92 ILPAHFDLVPNSCSPGDPLVLERP 21 I H NSCSPGDPLVLERP Sbjct: 20 IAEKHVKFTSNSCSPGDPLVLERP 43 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.9 bits (84), Expect = 0.013 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L+ NSCSPGDPLVLERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.9 bits (84), Expect = 0.013 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L+ NSCSPGDPLVLERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 37.9 bits (84), Expect = 0.013 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ + NSCSPGDPLVLERP Sbjct: 4 FTDTLISANI-VESNSCSPGDPLVLERP 30 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 37.9 bits (84), Expect = 0.013 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 74 DLVPNSCSPGDPLVLERP 21 D V NSCSPGDPLVLERP Sbjct: 13 DEVSNSCSPGDPLVLERP 30 >SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 37.9 bits (84), Expect = 0.013 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = -2 Query: 98 DIILPAHFDLVPNSCSPGDPLVLERP 21 D+ H + NSCSPGDPLVLERP Sbjct: 46 DLFSLQHVRALSNSCSPGDPLVLERP 71 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.9 bits (84), Expect = 0.013 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L+ NSCSPGDPLVLERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.9 bits (84), Expect = 0.013 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L+ NSCSPGDPLVLERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 37.9 bits (84), Expect = 0.013 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -2 Query: 80 HFDLVPNSCSPGDPLVLERP 21 H NSCSPGDPLVLERP Sbjct: 22 HLQAASNSCSPGDPLVLERP 41 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 37.9 bits (84), Expect = 0.013 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L+ NSCSPGDPLVLERP Sbjct: 40 LISNSCSPGDPLVLERP 56 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.9 bits (84), Expect = 0.013 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L+ NSCSPGDPLVLERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 37.9 bits (84), Expect = 0.013 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L+ NSCSPGDPLVLERP Sbjct: 34 LISNSCSPGDPLVLERP 50 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 37.9 bits (84), Expect = 0.013 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L+ NSCSPGDPLVLERP Sbjct: 21 LISNSCSPGDPLVLERP 37 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.9 bits (84), Expect = 0.013 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L+ NSCSPGDPLVLERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 37.9 bits (84), Expect = 0.013 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L+ NSCSPGDPLVLERP Sbjct: 31 LISNSCSPGDPLVLERP 47 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.5 bits (83), Expect = 0.018 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = -2 Query: 98 DIILPAHFDLVPNSCSPGDPLVLERP 21 DI + + NSCSPGDPLVLERP Sbjct: 24 DIEAKQRMEYLSNSCSPGDPLVLERP 49 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 37.5 bits (83), Expect = 0.018 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 +V NSCSPGDPLVLERP Sbjct: 347 IVSNSCSPGDPLVLERP 363 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 37.5 bits (83), Expect = 0.018 Identities = 18/30 (60%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = -2 Query: 104 FVDIILPAHF--DLVPNSCSPGDPLVLERP 21 + DII H + NSCSPGDPLVLERP Sbjct: 501 YKDIIESTHIVVTFLSNSCSPGDPLVLERP 530 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 37.5 bits (83), Expect = 0.018 Identities = 19/35 (54%), Positives = 22/35 (62%), Gaps = 7/35 (20%) Frame = -2 Query: 104 FVDIILPAHFDL-------VPNSCSPGDPLVLERP 21 F D ++ A+ DL NSCSPGDPLVLERP Sbjct: 4 FTDTLISANIDLQKRRSKRASNSCSPGDPLVLERP 38 >SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.5 bits (83), Expect = 0.018 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = -2 Query: 101 VDIILPAHFDLVPNSCSPGDPLVLERP 21 +++ F + NSCSPGDPLVLERP Sbjct: 7 LEVTFGKSFRVTSNSCSPGDPLVLERP 33 >SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.5 bits (83), Expect = 0.018 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -2 Query: 83 AHFDLVPNSCSPGDPLVLERP 21 + F NSCSPGDPLVLERP Sbjct: 3 SRFQATSNSCSPGDPLVLERP 23 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 37.5 bits (83), Expect = 0.018 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 +V NSCSPGDPLVLERP Sbjct: 77 IVSNSCSPGDPLVLERP 93 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 37.5 bits (83), Expect = 0.018 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +1 Query: 4 SSTAVAGRSRTSGSPGLQEF 63 SST+ GRSRTSGSPGLQEF Sbjct: 99 SSTSGGGRSRTSGSPGLQEF 118 >SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 37.5 bits (83), Expect = 0.018 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -2 Query: 80 HFDLVPNSCSPGDPLVLERP 21 H D NSCSPGDPLVLERP Sbjct: 106 HRDQRSNSCSPGDPLVLERP 125 >SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 37.5 bits (83), Expect = 0.018 Identities = 19/38 (50%), Positives = 23/38 (60%) Frame = -2 Query: 134 FCDTSRCH*LFVDIILPAHFDLVPNSCSPGDPLVLERP 21 F T H + +I+P + NSCSPGDPLVLERP Sbjct: 14 FLSTRTVHCSLILLIVP-NATAQSNSCSPGDPLVLERP 50 >SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.5 bits (83), Expect = 0.018 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 74 DLVPNSCSPGDPLVLERP 21 D + NSCSPGDPLVLERP Sbjct: 5 DEISNSCSPGDPLVLERP 22 >SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 37.5 bits (83), Expect = 0.018 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -2 Query: 80 HFDLVPNSCSPGDPLVLERP 21 + D NSCSPGDPLVLERP Sbjct: 59 YLDWTSNSCSPGDPLVLERP 78 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 37.5 bits (83), Expect = 0.018 Identities = 18/31 (58%), Positives = 21/31 (67%), Gaps = 3/31 (9%) Frame = -2 Query: 104 FVDIILPAHF---DLVPNSCSPGDPLVLERP 21 F D ++ A+ V NSCSPGDPLVLERP Sbjct: 4 FTDTLISANIISIAFVSNSCSPGDPLVLERP 34 >SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 37.5 bits (83), Expect = 0.018 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = -2 Query: 77 FDLVPNSCSPGDPLVLERP 21 +++ NSCSPGDPLVLERP Sbjct: 20 YEVTSNSCSPGDPLVLERP 38 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.5 bits (83), Expect = 0.018 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 +V NSCSPGDPLVLERP Sbjct: 11 MVSNSCSPGDPLVLERP 27 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.5 bits (83), Expect = 0.018 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 +V NSCSPGDPLVLERP Sbjct: 1 MVSNSCSPGDPLVLERP 17 >SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.5 bits (83), Expect = 0.018 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ + NSCSPGDPLVLERP Sbjct: 4 FTDTLISAN--IPSNSCSPGDPLVLERP 29 >SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 37.5 bits (83), Expect = 0.018 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ NSCSPGDPLVLERP Sbjct: 4 FTDTLISANIQ--SNSCSPGDPLVLERP 29 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 37.5 bits (83), Expect = 0.018 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -2 Query: 80 HFDLVPNSCSPGDPLVLERP 21 H L NSCSPGDPLVLERP Sbjct: 34 HRVLTSNSCSPGDPLVLERP 53 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 37.5 bits (83), Expect = 0.018 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 +V NSCSPGDPLVLERP Sbjct: 85 IVSNSCSPGDPLVLERP 101 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.5 bits (83), Expect = 0.018 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 +V NSCSPGDPLVLERP Sbjct: 6 IVSNSCSPGDPLVLERP 22 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.5 bits (83), Expect = 0.018 Identities = 18/30 (60%), Positives = 21/30 (70%), Gaps = 2/30 (6%) Frame = -2 Query: 104 FVDIILPAHFD--LVPNSCSPGDPLVLERP 21 F D ++ A+ V NSCSPGDPLVLERP Sbjct: 4 FTDTLISANIANAKVSNSCSPGDPLVLERP 33 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.5 bits (83), Expect = 0.018 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 +V NSCSPGDPLVLERP Sbjct: 1 MVSNSCSPGDPLVLERP 17 >SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.5 bits (83), Expect = 0.018 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 83 AHFDLVPNSCSPGDPLVLERP 21 A + ++ NSCSPGDPLVLERP Sbjct: 8 AFYFILSNSCSPGDPLVLERP 28 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 37.5 bits (83), Expect = 0.018 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -2 Query: 80 HFDLVPNSCSPGDPLVLERP 21 H ++ NSCSPGDPLVLERP Sbjct: 22 HNIVISNSCSPGDPLVLERP 41 >SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.5 bits (83), Expect = 0.018 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ + NSCSPGDPLVLERP Sbjct: 4 FTDTLISAN--IPSNSCSPGDPLVLERP 29 >SB_2166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.5 bits (83), Expect = 0.018 Identities = 17/29 (58%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -2 Query: 104 FVDIILPAHFDLVP-NSCSPGDPLVLERP 21 F D ++ A+ + NSCSPGDPLVLERP Sbjct: 4 FTDTLISANIRVFESNSCSPGDPLVLERP 32 >SB_175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.5 bits (83), Expect = 0.018 Identities = 17/29 (58%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -2 Query: 104 FVDIILPAHFDL-VPNSCSPGDPLVLERP 21 F D ++ A+ + NSCSPGDPLVLERP Sbjct: 4 FTDTLISANIIVYTSNSCSPGDPLVLERP 32 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 77 FDLVPNSCSPGDPLVLERP 21 F + NSCSPGDPLVLERP Sbjct: 50 FRVASNSCSPGDPLVLERP 68 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 74 DLVPNSCSPGDPLVLERP 21 D + NSCSPGDPLVLERP Sbjct: 22 DRLSNSCSPGDPLVLERP 39 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.1 bits (82), Expect = 0.023 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = -2 Query: 95 IILPAHFDLVPNSCSPGDPLVLERP 21 I+L F V NSCSPGDPLVLERP Sbjct: 26 ILLQVGFK-VSNSCSPGDPLVLERP 49 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 37.1 bits (82), Expect = 0.023 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 80 HFDLVPNSCSPGDPLVLERP 21 HF V NSCSPGDPLVLERP Sbjct: 29 HFR-VSNSCSPGDPLVLERP 47 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 +V NSCSPGDPLVLERP Sbjct: 3474 VVSNSCSPGDPLVLERP 3490 >SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) Length = 123 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 23 AALELVDPPGCRNSAPDQN 79 AALELVDPPGCRNS D N Sbjct: 11 AALELVDPPGCRNSIEDFN 29 >SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.1 bits (82), Expect = 0.023 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ NSCSPGDPLVLERP Sbjct: 4 FTDTLISANIG--SNSCSPGDPLVLERP 29 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 +V NSCSPGDPLVLERP Sbjct: 7 VVSNSCSPGDPLVLERP 23 >SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 18/21 (85%), Gaps = 1/21 (4%) Frame = -2 Query: 80 HFDLVP-NSCSPGDPLVLERP 21 H ++P NSCSPGDPLVLERP Sbjct: 61 HTPILPSNSCSPGDPLVLERP 81 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L+ NSCSPGDPLVLERP Sbjct: 2 LLSNSCSPGDPLVLERP 18 >SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -2 Query: 80 HFDLVPNSCSPGDPLVLERP 21 H NSCSPGDPLVLERP Sbjct: 10 HIHRASNSCSPGDPLVLERP 29 >SB_45961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -2 Query: 86 PAHFDLVPNSCSPGDPLVLERP 21 P F NSCSPGDPLVLERP Sbjct: 6 PGTFGNSSNSCSPGDPLVLERP 27 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L+ NSCSPGDPLVLERP Sbjct: 6 LLSNSCSPGDPLVLERP 22 >SB_40987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -2 Query: 74 DLVPNSCSPGDPLVLERP 21 D NSCSPGDPLVLERP Sbjct: 50 DTTSNSCSPGDPLVLERP 67 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 +V NSCSPGDPLVLERP Sbjct: 19 VVSNSCSPGDPLVLERP 35 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.1 bits (82), Expect = 0.023 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 ++ NSCSPGDPLVLERP Sbjct: 5 IISNSCSPGDPLVLERP 21 >SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = -2 Query: 95 IILPAHFDLVP-NSCSPGDPLVLERP 21 +++ VP NSCSPGDPLVLERP Sbjct: 3 VVITLSLGFVPSNSCSPGDPLVLERP 28 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.1 bits (82), Expect = 0.023 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -2 Query: 74 DLVPNSCSPGDPLVLERP 21 +++ NSCSPGDPLVLERP Sbjct: 4 NVISNSCSPGDPLVLERP 21 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.1 bits (82), Expect = 0.023 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 ++ NSCSPGDPLVLERP Sbjct: 1 MISNSCSPGDPLVLERP 17 >SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.1 bits (82), Expect = 0.023 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ + NSCSPGDPLVLERP Sbjct: 4 FTDTLISAN--IRSNSCSPGDPLVLERP 29 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L+ NSCSPGDPLVLERP Sbjct: 1 LLSNSCSPGDPLVLERP 17 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 74 DLVPNSCSPGDPLVLERP 21 + V NSCSPGDPLVLERP Sbjct: 6 EAVSNSCSPGDPLVLERP 23 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.1 bits (82), Expect = 0.023 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 ++ NSCSPGDPLVLERP Sbjct: 4 IISNSCSPGDPLVLERP 20 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 37.1 bits (82), Expect = 0.023 Identities = 17/18 (94%), Positives = 17/18 (94%), Gaps = 1/18 (5%) Frame = -2 Query: 71 LVP-NSCSPGDPLVLERP 21 LVP NSCSPGDPLVLERP Sbjct: 27 LVPSNSCSPGDPLVLERP 44 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L+ NSCSPGDPLVLERP Sbjct: 7 LLSNSCSPGDPLVLERP 23 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 +V NSCSPGDPLVLERP Sbjct: 27 VVSNSCSPGDPLVLERP 43 >SB_8834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.1 bits (82), Expect = 0.023 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ NSCSPGDPLVLERP Sbjct: 4 FTDTLISANIG--SNSCSPGDPLVLERP 29 >SB_8733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -2 Query: 77 FDLVPNSCSPGDPLVLERP 21 F++ NSCSPGDPLVLERP Sbjct: 2 FNVGSNSCSPGDPLVLERP 20 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 37.1 bits (82), Expect = 0.023 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 ++ NSCSPGDPLVLERP Sbjct: 26 IISNSCSPGDPLVLERP 42 >SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -2 Query: 80 HFDLVPNSCSPGDPLVLERP 21 H NSCSPGDPLVLERP Sbjct: 10 HSQTTSNSCSPGDPLVLERP 29 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 30 VSNSCSPGDPLVLERP 45 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 36.7 bits (81), Expect = 0.031 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -2 Query: 74 DLVPNSCSPGDPLVLERP 21 + + NSCSPGDPLVLERP Sbjct: 259 EYISNSCSPGDPLVLERP 276 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 10 VSNSCSPGDPLVLERP 25 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 36.7 bits (81), Expect = 0.031 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -2 Query: 89 LPAHFDLVPNSCSPGDPLVLERP 21 LP H NSCSPGDPLVLERP Sbjct: 158 LPPHLS---NSCSPGDPLVLERP 177 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 15 VSNSCSPGDPLVLERP 30 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 2 VSNSCSPGDPLVLERP 17 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 15 LTSNSCSPGDPLVLERP 31 >SB_28961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 36.7 bits (81), Expect = 0.031 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 64 RIPAARGIH*F*SGPPPRWSS 2 RIPAARGIH PPPRWSS Sbjct: 12 RIPAARGIHYVLERPPPRWSS 32 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = +2 Query: 23 AALELVDPPGCRNSAPDQNE 82 AALELVDPPGCRNS N+ Sbjct: 655 AALELVDPPGCRNSISSSNQ 674 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 40 VSNSCSPGDPLVLERP 55 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 117 VSNSCSPGDPLVLERP 132 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 184 VSNSCSPGDPLVLERP 199 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 1066 VSNSCSPGDPLVLERP 1081 >SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 36.7 bits (81), Expect = 0.031 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = -2 Query: 92 ILPAHFDLVPNSCSPGDPLVLERP 21 IL H NSCSPGDPLVLERP Sbjct: 21 ILLVHDHNQSNSCSPGDPLVLERP 44 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 78 LTSNSCSPGDPLVLERP 94 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 3 VSNSCSPGDPLVLERP 18 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 214 VSNSCSPGDPLVLERP 229 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 5 LASNSCSPGDPLVLERP 21 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 36.7 bits (81), Expect = 0.031 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -2 Query: 83 AHFDLVPNSCSPGDPLVLERP 21 + + + NSCSPGDPLVLERP Sbjct: 147 SRLEKISNSCSPGDPLVLERP 167 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 5 VSNSCSPGDPLVLERP 20 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 7 VSNSCSPGDPLVLERP 22 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 4 VSNSCSPGDPLVLERP 19 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 6 LASNSCSPGDPLVLERP 22 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 4 VSNSCSPGDPLVLERP 19 >SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) Length = 727 Score = 36.7 bits (81), Expect = 0.031 Identities = 20/36 (55%), Positives = 20/36 (55%), Gaps = 4/36 (11%) Frame = -2 Query: 116 CH*LFVDI----ILPAHFDLVPNSCSPGDPLVLERP 21 CH F D I F NSCSPGDPLVLERP Sbjct: 27 CHLAFFDYGPNEIKKPIFKPTSNSCSPGDPLVLERP 62 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 25 VSNSCSPGDPLVLERP 40 >SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 36.7 bits (81), Expect = 0.031 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = +2 Query: 23 AALELVDPPGCRNSAPDQNELARL 94 AALELVDPPGCRNS D + L L Sbjct: 11 AALELVDPPGCRNSILDPSPLPYL 34 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 17 LASNSCSPGDPLVLERP 33 >SB_44850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 36.7 bits (81), Expect = 0.031 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = -2 Query: 104 FVDIILPAHFDLVPNSCSPGDPLVLERP 21 F D ++ A+ NSCSPGDPLVLERP Sbjct: 4 FTDTLISANIT-GSNSCSPGDPLVLERP 30 >SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) Length = 210 Score = 36.7 bits (81), Expect = 0.031 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = -2 Query: 89 LPAHFDLVPNSCSPGDPLVLERP 21 +P L NSCSPGDPLVLERP Sbjct: 79 VPKSEPLSSNSCSPGDPLVLERP 101 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 10 VSNSCSPGDPLVLERP 25 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 59 VSNSCSPGDPLVLERP 74 >SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 36.7 bits (81), Expect = 0.031 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = -2 Query: 77 FDLVPNSCSPGDPLVLERP 21 +++ NSCSPGDPLVLERP Sbjct: 32 YNIPSNSCSPGDPLVLERP 50 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 4 VSNSCSPGDPLVLERP 19 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 41 VSNSCSPGDPLVLERP 56 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 15 VSNSCSPGDPLVLERP 30 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 4 VSNSCSPGDPLVLERP 19 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 14 VSNSCSPGDPLVLERP 29 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 6 VSNSCSPGDPLVLERP 21 >SB_32003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -2 Query: 74 DLVPNSCSPGDPLVLERP 21 D NSCSPGDPLVLERP Sbjct: 10 DRTSNSCSPGDPLVLERP 27 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 18 VSNSCSPGDPLVLERP 33 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 20 LASNSCSPGDPLVLERP 36 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 30 VSNSCSPGDPLVLERP 45 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 32 VSNSCSPGDPLVLERP 47 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 10 VSNSCSPGDPLVLERP 25 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 17 VSNSCSPGDPLVLERP 32 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 14 VSNSCSPGDPLVLERP 29 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 34 VSNSCSPGDPLVLERP 49 >SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -2 Query: 80 HFDLVPNSCSPGDPLVLERP 21 +F NSCSPGDPLVLERP Sbjct: 60 YFPETSNSCSPGDPLVLERP 79 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 88 LTSNSCSPGDPLVLERP 104 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 36.7 bits (81), Expect = 0.031 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 ++ NSCSPGDPLVLERP Sbjct: 17 VISNSCSPGDPLVLERP 33 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 10 VSNSCSPGDPLVLERP 25 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 11 LASNSCSPGDPLVLERP 27 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 3 LASNSCSPGDPLVLERP 19 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 15 LTSNSCSPGDPLVLERP 31 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/24 (62%), Positives = 19/24 (79%) Frame = +2 Query: 23 AALELVDPPGCRNSAPDQNELARL 94 AALELVDPPGCRNS +N + ++ Sbjct: 87 AALELVDPPGCRNSIAGKNTVTQV 110 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 661 LASNSCSPGDPLVLERP 677 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 7 LASNSCSPGDPLVLERP 23 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 193 VSNSCSPGDPLVLERP 208 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 9 VSNSCSPGDPLVLERP 24 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 11 LTSNSCSPGDPLVLERP 27 >SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.7 bits (81), Expect = 0.031 Identities = 16/23 (69%), Positives = 19/23 (82%), Gaps = 3/23 (13%) Frame = -2 Query: 80 HFDLVP---NSCSPGDPLVLERP 21 +F ++P NSCSPGDPLVLERP Sbjct: 7 NFGIIPKPSNSCSPGDPLVLERP 29 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 96 LASNSCSPGDPLVLERP 112 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 L NSCSPGDPLVLERP Sbjct: 4 LASNSCSPGDPLVLERP 20 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 V NSCSPGDPLVLERP Sbjct: 10 VSNSCSPGDPLVLERP 25 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 36.3 bits (80), Expect = 0.041 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 5 ISNSCSPGDPLVLERP 20 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 36.3 bits (80), Expect = 0.041 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 101 ISNSCSPGDPLVLERP 116 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 36.3 bits (80), Expect = 0.041 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 16 ISNSCSPGDPLVLERP 31 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 36.3 bits (80), Expect = 0.041 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -2 Query: 74 DLVPNSCSPGDPLVLERP 21 ++ NSCSPGDPLVLERP Sbjct: 36 NIASNSCSPGDPLVLERP 53 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 36.3 bits (80), Expect = 0.041 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = +2 Query: 23 AALELVDPPGCRNSAPDQNELARL 94 AALELVDPPGCRNS D N++ +L Sbjct: 11 AALELVDPPGCRNSI-DINDMKQL 33 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.3 bits (80), Expect = 0.041 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 21 ISNSCSPGDPLVLERP 36 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 36.3 bits (80), Expect = 0.041 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 59 ISNSCSPGDPLVLERP 74 >SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 36.3 bits (80), Expect = 0.041 Identities = 16/26 (61%), Positives = 22/26 (84%), Gaps = 1/26 (3%) Frame = -2 Query: 95 IILPAHFDLVP-NSCSPGDPLVLERP 21 +++ ++F +V NSCSPGDPLVLERP Sbjct: 2 VLVNSNFWIVTSNSCSPGDPLVLERP 27 >SB_24515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 36.3 bits (80), Expect = 0.041 Identities = 15/39 (38%), Positives = 25/39 (64%) Frame = +3 Query: 126 VTKAAIAGHDGNVWAKSEGFEISKDEVAKIVAGFENESL 242 V +AAI G DG+ WA S GF +S+ E +++ ++ S+ Sbjct: 7 VQRAAIHGLDGSCWATSSGFSVSQQEAMELLKSLKDGSV 45 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 36.3 bits (80), Expect = 0.041 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 9 ISNSCSPGDPLVLERP 24 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.3 bits (80), Expect = 0.041 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 10 ISNSCSPGDPLVLERP 25 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.3 bits (80), Expect = 0.041 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 3 ISNSCSPGDPLVLERP 18 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.3 bits (80), Expect = 0.041 Identities = 20/33 (60%), Positives = 22/33 (66%), Gaps = 5/33 (15%) Frame = -2 Query: 104 FVDIILPA---HFDLVP--NSCSPGDPLVLERP 21 F D ++ A H L P NSCSPGDPLVLERP Sbjct: 4 FTDTLISANIPHELLAPTSNSCSPGDPLVLERP 36 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 36.3 bits (80), Expect = 0.041 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 ++ NSCSPGDPLVLERP Sbjct: 55 ILSNSCSPGDPLVLERP 71 >SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.3 bits (80), Expect = 0.041 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 13 ISNSCSPGDPLVLERP 28 >SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.3 bits (80), Expect = 0.041 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 4 ISNSCSPGDPLVLERP 19 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 36.3 bits (80), Expect = 0.041 Identities = 15/19 (78%), Positives = 18/19 (94%) Frame = +1 Query: 22 GRSRTSGSPGLQEFGTRSK 78 GRSRTSGSPGLQEF T+++ Sbjct: 10 GRSRTSGSPGLQEFDTKNQ 28 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 36.3 bits (80), Expect = 0.041 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 52 ISNSCSPGDPLVLERP 67 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 36.3 bits (80), Expect = 0.041 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 51 ISNSCSPGDPLVLERP 66 >SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 36.3 bits (80), Expect = 0.041 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -2 Query: 83 AHFDLVPNSCSPGDPLVLERP 21 A L NSCSPGDPLVLERP Sbjct: 30 APLKLSSNSCSPGDPLVLERP 50 >SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 36.3 bits (80), Expect = 0.041 Identities = 17/21 (80%), Positives = 18/21 (85%), Gaps = 1/21 (4%) Frame = +2 Query: 23 AALELVDPPGCRNS-APDQNE 82 AALELVDPPGCRNS A D N+ Sbjct: 11 AALELVDPPGCRNSIAADANQ 31 >SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 36.3 bits (80), Expect = 0.041 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -2 Query: 80 HFDLVPNSCSPGDPLVLERP 21 H NSCSPGDPLVLERP Sbjct: 10 HSGKASNSCSPGDPLVLERP 29 >SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.3 bits (80), Expect = 0.041 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 21 ISNSCSPGDPLVLERP 36 >SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.3 bits (80), Expect = 0.041 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 4 ISNSCSPGDPLVLERP 19 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 36.3 bits (80), Expect = 0.041 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 47 ISNSCSPGDPLVLERP 62 >SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.3 bits (80), Expect = 0.041 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 4 ISNSCSPGDPLVLERP 19 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 36.3 bits (80), Expect = 0.041 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 32 ISNSCSPGDPLVLERP 47 >SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 36.3 bits (80), Expect = 0.041 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 74 DLVPNSCSPGDPLVLERP 21 D + NSCSPGDPLVLERP Sbjct: 4 DDLSNSCSPGDPLVLERP 21 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 36.3 bits (80), Expect = 0.041 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 18 ISNSCSPGDPLVLERP 33 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 36.3 bits (80), Expect = 0.041 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 32 ISNSCSPGDPLVLERP 47 >SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 36.3 bits (80), Expect = 0.041 Identities = 17/32 (53%), Positives = 22/32 (68%), Gaps = 4/32 (12%) Frame = -2 Query: 104 FVDIILPAHF----DLVPNSCSPGDPLVLERP 21 F D ++ A+ ++ NSCSPGDPLVLERP Sbjct: 4 FTDTLISANIICSRTVLSNSCSPGDPLVLERP 35 >SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) Length = 1098 Score = 36.3 bits (80), Expect = 0.041 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 974 ISNSCSPGDPLVLERP 989 >SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 36.3 bits (80), Expect = 0.041 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 68 VPNSCSPGDPLVLERP 21 + NSCSPGDPLVLERP Sbjct: 6 ISNSCSPGDPLVLERP 21 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 36.3 bits (80), Expect = 0.041 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERP 21 ++ NSCSPGDPLVLERP Sbjct: 65 MLSNSCSPGDPLVLERP 81 >SB_39848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.3 bits (80), Expect = 0.041 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -2 Query: 86 PAHFDLVPNSCSPGDPLVLERP 21 P F NSCSPGDPLVLERP Sbjct: 8 PLMFTDPSNSCSPGDPLVLERP 29 >SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 36.3 bits (80), Expect = 0.041 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -2 Query: 83 AHFDLVPNSCSPGDPLVLERP 21 A F+L NSCSPGDPLVLERP Sbjct: 57 AAFEL-SNSCSPGDPLVLERP 76 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,137,483 Number of Sequences: 59808 Number of extensions: 413640 Number of successful extensions: 3983 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2466 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3983 length of database: 16,821,457 effective HSP length: 83 effective length of database: 11,857,393 effective search space used: 3130351752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -