BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30371 (646 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z32645-1|CAA83567.1| 258|Anopheles gambiae chymotrypsinogen-lik... 24 3.6 Z18888-1|CAA79326.1| 258|Anopheles gambiae chymotrypsin 2 protein. 24 3.6 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 24 4.7 Z32645-2|CAA83568.1| 259|Anopheles gambiae chymotrypsin-like pr... 23 6.3 Z18887-1|CAA79325.1| 259|Anopheles gambiae chymotrypsin 1 protein. 23 6.3 >Z32645-1|CAA83567.1| 258|Anopheles gambiae chymotrypsinogen-like protease ANCHYM2 protein. Length = 258 Score = 24.2 bits (50), Expect = 3.6 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -1 Query: 259 NLADNYSLSAKVNSWRHRSDNSFPHFHWVGTA 164 N + Y +S +V W H S + WV TA Sbjct: 41 NCSAPYQVSLQVPGWGHNCGGSLLNDRWVLTA 72 >Z18888-1|CAA79326.1| 258|Anopheles gambiae chymotrypsin 2 protein. Length = 258 Score = 24.2 bits (50), Expect = 3.6 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -1 Query: 259 NLADNYSLSAKVNSWRHRSDNSFPHFHWVGTA 164 N + Y +S +V W H S + WV TA Sbjct: 41 NCSAPYQVSLQVPGWGHNCGGSLLNDRWVLTA 72 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.8 bits (49), Expect = 4.7 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -1 Query: 376 INVDYIAEGYPKLACLVIFK 317 + +D + E YP+LA V+FK Sbjct: 779 VALDRLVENYPRLARSVLFK 798 >Z32645-2|CAA83568.1| 259|Anopheles gambiae chymotrypsin-like protease ANCHYM1 protein. Length = 259 Score = 23.4 bits (48), Expect = 6.3 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = -1 Query: 244 YSLSAKVNSWRHRSDNSFPHFHWVGTA 164 Y +S +V W H S + WV TA Sbjct: 46 YQVSLQVPGWGHNCGGSLLNDRWVLTA 72 >Z18887-1|CAA79325.1| 259|Anopheles gambiae chymotrypsin 1 protein. Length = 259 Score = 23.4 bits (48), Expect = 6.3 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = -1 Query: 244 YSLSAKVNSWRHRSDNSFPHFHWVGTA 164 Y +S +V W H S + WV TA Sbjct: 46 YQVSLQVPGWGHNCGGSLLNDRWVLTA 72 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 658,770 Number of Sequences: 2352 Number of extensions: 12687 Number of successful extensions: 22 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63559560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -