BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30368 (669 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g75150.1 68414.m08729 expressed protein ; expression supporte... 33 0.23 At5g02880.1 68418.m00231 HECT-domain-containing protein / ubiqui... 29 3.7 At1g49900.1 68414.m05596 zinc finger (C2H2 type) family protein ... 28 4.9 At2g45290.1 68415.m05637 transketolase, putative strong similari... 27 8.5 >At1g75150.1 68414.m08729 expressed protein ; expression supported by MPSS Length = 753 Score = 32.7 bits (71), Expect = 0.23 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = +3 Query: 354 HCSADVSAKSTNTETPCVTASRTVPTRQTPDAWCAQTSTKPGNRIAKYTASEL 512 HCS D + S N+++P + + PT Q P C QT + K ++ L Sbjct: 308 HCSEDSAGPSENSDSPSKREAESNPTHQDPSV-CPQTINSGDELLEKMSSRSL 359 >At5g02880.1 68418.m00231 HECT-domain-containing protein / ubiquitin-transferase family protein / armadillo/beta-catenin-like repeat-containing protein similar to SP|Q14669 Thyroid receptor interacting protein 12 (TRIP12) {Homo sapiens}; contains Pfam profiles PF00632: HECT-domain (ubiquitin-transferase), PF00514: Armadillo/beta-catenin-like repeat Length = 1502 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +1 Query: 565 IEYYGTAEKCLTALKARCLTSPVAC 639 IEY AE+CL AL+ PVAC Sbjct: 208 IEYLDVAEQCLQALEKISRDEPVAC 232 >At1g49900.1 68414.m05596 zinc finger (C2H2 type) family protein contains Pfam profile: PF00096 zinc finger, C2H2 type Length = 917 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/43 (27%), Positives = 19/43 (44%) Frame = -1 Query: 129 PTPHTLASAVQMTAITRANARRPFILPFDDSFLCEAGGNRVES 1 PTPH+ T + + + +LP DS+ C G + S Sbjct: 719 PTPHSQTQPQSQTQLQKVTQPQTQMLPKSDSYQCNVCGRELPS 761 >At2g45290.1 68415.m05637 transketolase, putative strong similarity to transketolase 1 [Capsicum annuum] GI:3559814; contains Pfam profiles PF02779: Transketolase, pyridine binding domain, PF02780: Transketolase, C-terminal domain, PF00456: Transketolase, thiamine diphosphate binding domain Length = 741 Score = 27.5 bits (58), Expect = 8.5 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = -3 Query: 577 RNTRFERGGIADHGTDQSCRGISSLAVYFAIRLPGFVEVCA 455 RN RF G+ +HG C GI A+ PGF+ CA Sbjct: 480 RNLRF---GVREHGMGAICNGI-------ALHSPGFIPYCA 510 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,022,191 Number of Sequences: 28952 Number of extensions: 268933 Number of successful extensions: 793 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 778 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 792 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1412971776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -