BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30367 (618 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 25 0.45 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 3.2 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 5.5 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 25.4 bits (53), Expect = 0.45 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = -3 Query: 289 HYVVEREISPLRFNALQSPAPALRQTLRPRRRWPPGTVG 173 +Y++ E SP NA SPA T R P G+ G Sbjct: 729 NYIMRGEASPRSPNASPSPAEQCASTTTITARSPQGSQG 767 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 22.6 bits (46), Expect = 3.2 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -1 Query: 135 GELHLVHALAGVPMQESLAPEHSGELFRDALEQLLDG 25 G++HL A+ Q+ P H G + + L ++ DG Sbjct: 910 GQIHLTVAVVQYKTQDGFGPIHYG-VCSNYLREISDG 945 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.8 bits (44), Expect = 5.5 Identities = 10/29 (34%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = -2 Query: 143 SASVNSISSMPSPVYQCKKALR-LNIAVN 60 +AS NS+ S+P ++ + LR +++A N Sbjct: 267 NASYNSLDSLPEGLFASTRDLREIHLAYN 295 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,683 Number of Sequences: 438 Number of extensions: 2777 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18337950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -