BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30365 (615 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q54UC1 Cluster: Heat shock factor (HSF)-type DNA-bindin... 33 4.1 >UniRef50_Q54UC1 Cluster: Heat shock factor (HSF)-type DNA-binding domain-containing protein; n=1; Dictyostelium discoideum AX4|Rep: Heat shock factor (HSF)-type DNA-binding domain-containing protein - Dictyostelium discoideum AX4 Length = 751 Score = 33.5 bits (73), Expect = 4.1 Identities = 18/46 (39%), Positives = 28/46 (60%) Frame = -2 Query: 449 VKINNLLTVIN*LSLGNRINEITRTLVYVYHNFQL*YNEHKVTYSS 312 +KINN ++ IN S + I + L+Y + FQ+ YNE K ++SS Sbjct: 185 MKINNNMSGINSNSYNSADKAILQQLLYQFTKFQVDYNELKFSHSS 230 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 491,610,919 Number of Sequences: 1657284 Number of extensions: 8182882 Number of successful extensions: 13873 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 13584 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13872 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 44392209541 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -