BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30364 (553 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF039037-6|AAC48230.2| 129|Caenorhabditis elegans Seven tm rece... 28 3.9 Z81592-9|CAB63315.1| 945|Caenorhabditis elegans Hypothetical pr... 27 9.0 >AF039037-6|AAC48230.2| 129|Caenorhabditis elegans Seven tm receptor protein 121 protein. Length = 129 Score = 28.3 bits (60), Expect = 3.9 Identities = 13/27 (48%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +1 Query: 10 RSLLVCWRRVLPD-HPASRPASRHQLH 87 R + CWRRVLP +SRPA H Sbjct: 100 RDAVFCWRRVLPSMMSSSRPAKHTSSH 126 >Z81592-9|CAB63315.1| 945|Caenorhabditis elegans Hypothetical protein T16G1.9 protein. Length = 945 Score = 27.1 bits (57), Expect = 9.0 Identities = 10/46 (21%), Positives = 23/46 (50%) Frame = +1 Query: 250 THGDNKSQHESRDGDAVHGEYTLVEADGSVRKVEYTADDHHGFNAI 387 T+G H +G++V + T + +DG+++++ F A+ Sbjct: 419 TNGHASGDHSHSNGNSVSKQLTDISSDGTIKELTIRDQPDRAFRAV 464 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,091,634 Number of Sequences: 27780 Number of extensions: 110603 Number of successful extensions: 443 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 422 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 443 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1123720628 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -