BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30363 (514 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_04_0129 + 17520753-17520842,17521651-17521741,17521887-175220... 106 9e-24 02_01_0385 + 2783387-2783695,2784149-2785082,2785206-2785309,278... 28 3.8 12_01_0457 + 3601652-3601903,3603399-3603779 28 5.1 07_03_0493 + 18747427-18748356,18748594-18748697,18749586-187497... 27 6.7 03_02_0901 + 12267042-12267182,12267949-12268095,12268163-122682... 27 6.7 05_01_0089 + 589457-589506,589598-589741,589820-589903,590118-59... 27 8.8 01_06_1208 + 35424241-35424370,35424415-35424728,35424782-354249... 27 8.8 >03_04_0129 + 17520753-17520842,17521651-17521741,17521887-17522070, 17522149-17522224 Length = 146 Score = 106 bits (255), Expect = 9e-24 Identities = 46/79 (58%), Positives = 61/79 (77%) Frame = +3 Query: 18 TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAILRHI 197 TVKDV + VK +AHLK++GK+++PE +D+VKTARFKEL PYDPDW+Y R A+I R I Sbjct: 8 TVKDVNPHEFVKAYSAHLKRSGKMELPEWVDIVKTARFKELPPYDPDWYYTRAASIARKI 67 Query: 198 YIRSPVGVKTVTKIFGGRK 254 Y+R +GV KI+GGR+ Sbjct: 68 YLRQGIGVGGFQKIYGGRQ 86 Score = 64.5 bits (150), Expect = 5e-11 Identities = 26/52 (50%), Positives = 39/52 (75%) Frame = +2 Query: 251 QSNGVTPSHFCRSSGSIARKALQSLEALKLVEKVQDGGRILTTQGRRDLDRI 406 Q NG P HFC+SSG+I+R LQ L+ + +++ GGR++T+QGRRDLD++ Sbjct: 86 QRNGSRPPHFCKSSGAISRNILQQLQKMGIIDVDPKGGRLITSQGRRDLDQV 137 >02_01_0385 + 2783387-2783695,2784149-2785082,2785206-2785309, 2785402-2785486,2785517-2787578,2787732-2787753, 2788157-2788327,2791473-2791517,2792558-2793874, 2793962-2794012,2794090-2794188,2794352-2794504, 2794554-2794571 Length = 1789 Score = 28.3 bits (60), Expect = 3.8 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = -3 Query: 125 SCLYKIHVLRYLDFARFF*VS-SDSFNNLVLFNILYCDGTHL 3 S +YK+ +LRYLD + S S SFN+L+ L T+L Sbjct: 550 SSVYKLKLLRYLDASSLRISSFSKSFNHLLNLQALILSNTYL 591 >12_01_0457 + 3601652-3601903,3603399-3603779 Length = 210 Score = 27.9 bits (59), Expect = 5.1 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 5/48 (10%) Frame = +3 Query: 198 YIRSPVGVKTVTKIFGGRKVMELHLHISAG-----HQAVLHARLCNRW 326 Y+ S ++ ++FGG L LH+ G HQ V+ + +RW Sbjct: 100 YVPSGTTGVSIMQVFGGGTATTLMLHVYGGDLWYYHQQVVETNIYDRW 147 >07_03_0493 + 18747427-18748356,18748594-18748697,18749586-18749795, 18749992-18750597,18750819-18751095,18751163-18751310, 18751957-18752044,18752167-18752284 Length = 826 Score = 27.5 bits (58), Expect = 6.7 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = -2 Query: 249 AHQRSW*QS*LQQVSECKYDEGWQHNAHRTNQGHTEPAL*SELSLQDPCAQV 94 A QR Q L VS EGWQH++ + L E+ ++ AQV Sbjct: 671 ADQRVSAQCSLAPVSHLHQQEGWQHSSFEHQHHENQNFLEMEVRVRSEMAQV 722 >03_02_0901 + 12267042-12267182,12267949-12268095,12268163-12268253, 12268367-12268485,12268779-12268969,12269440-12269650, 12270072-12270309,12270944-12271329,12271933-12271956, 12271984-12272077,12272341-12272525,12273025-12273255, 12273665-12273730,12273816-12274034,12274764-12275003, 12275244-12275423,12276269-12276535,12276612-12276815, 12276896-12277048 Length = 1128 Score = 27.5 bits (58), Expect = 6.7 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +3 Query: 36 QDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAILRHIY 200 +D+I+ + ++ V+VP + +LV TA L P D W +R A LR + Sbjct: 947 EDRILMSDIVFMRAWVNVEVPTYCNLVTTA----LQPQDETWQGMRTTAELRRAH 997 >05_01_0089 + 589457-589506,589598-589741,589820-589903,590118-590261, 590351-590401,590492-590641,591175-591488,592685-592815, 593131-593451,594994-595057,595322-595443 Length = 524 Score = 27.1 bits (57), Expect = 8.8 Identities = 12/54 (22%), Positives = 26/54 (48%) Frame = +3 Query: 3 KMRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWF 164 ++ ++ V D +++ + + H K TG ++ E+ ++ L PY D F Sbjct: 224 EVAALIVNDTSENQKGRDIIVHYKDTGPRRISENHPKFMAMQYPLLFPYGEDGF 277 >01_06_1208 + 35424241-35424370,35424415-35424728,35424782-35424967, 35425361-35425523,35425601-35425787,35425875-35426016 Length = 373 Score = 27.1 bits (57), Expect = 8.8 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 362 HRPELSQQASMPPTIAKPCVQYCLMTCRN 276 H + + + P TIA+ +QYCL TC N Sbjct: 116 HPTQDPEATNSPFTIAQLQLQYCLHTCTN 144 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,587,435 Number of Sequences: 37544 Number of extensions: 250562 Number of successful extensions: 631 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 624 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 631 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1106928780 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -