BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30361 (619 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier prot... 153 4e-39 L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier prot... 153 4e-39 AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocas... 153 4e-39 CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 33 0.006 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 23 1.4 M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 25 2.6 AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant r... 24 3.4 DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. 23 6.0 >L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 153 bits (371), Expect = 4e-39 Identities = 73/87 (83%), Positives = 79/87 (90%) Frame = +2 Query: 257 AAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANV 436 AAVSKTAVAPIERVKLLLQVQ SKQIA D++YKGIVD FVRIPKEQG+ +FWRGN ANV Sbjct: 21 AAVSKTAVAPIERVKLLLQVQAASKQIAVDKQYKGIVDCFVRIPKEQGIGAFWRGNLANV 80 Query: 437 IRYFPTQALNFAFKDKYKQVFLGGLTR 517 IRYFPTQALNFAFKD YKQVFLGG+ + Sbjct: 81 IRYFPTQALNFAFKDVYKQVFLGGVDK 107 Score = 35.5 bits (78), Expect = 0.001 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 525 FWRYFXXXXXXXXXXXXTSLCFV*PLDFGST 617 FWRYF TSLCFV PLDF T Sbjct: 111 FWRYFLGNLGSGGAAGATSLCFVYPLDFART 141 Score = 35.5 bits (78), Expect = 0.001 Identities = 22/69 (31%), Positives = 39/69 (56%) Frame = +2 Query: 284 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQAL 463 P + V+ + +Q S ++ YK +D +V+I K++G +F++G F+NV+R AL Sbjct: 232 PFDTVRRRMMMQ--SWPCKSEVMYKNTLDCWVKIGKQEGSGAFFKGAFSNVLR-GTGGAL 288 Query: 464 NFAFKDKYK 490 F D+ K Sbjct: 289 VLVFYDEVK 297 Score = 32.7 bits (71), Expect = 0.010 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = +3 Query: 198 MSNLADPVAFAKDFLAGGI 254 M+ ADP FAKDFLAGGI Sbjct: 1 MTKKADPYGFAKDFLAGGI 19 >L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 153 bits (371), Expect = 4e-39 Identities = 73/87 (83%), Positives = 79/87 (90%) Frame = +2 Query: 257 AAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANV 436 AAVSKTAVAPIERVKLLLQVQ SKQIA D++YKGIVD FVRIPKEQG+ +FWRGN ANV Sbjct: 21 AAVSKTAVAPIERVKLLLQVQAASKQIAVDKQYKGIVDCFVRIPKEQGIGAFWRGNLANV 80 Query: 437 IRYFPTQALNFAFKDKYKQVFLGGLTR 517 IRYFPTQALNFAFKD YKQVFLGG+ + Sbjct: 81 IRYFPTQALNFAFKDVYKQVFLGGVDK 107 Score = 35.5 bits (78), Expect = 0.001 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 525 FWRYFXXXXXXXXXXXXTSLCFV*PLDFGST 617 FWRYF TSLCFV PLDF T Sbjct: 111 FWRYFLGNLGSGGAAGATSLCFVYPLDFART 141 Score = 35.5 bits (78), Expect = 0.001 Identities = 22/69 (31%), Positives = 39/69 (56%) Frame = +2 Query: 284 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQAL 463 P + V+ + +Q S ++ YK +D +V+I K++G +F++G F+NV+R AL Sbjct: 232 PFDTVRRRMMMQ--SWPCKSEVMYKNTLDCWVKIGKQEGSGAFFKGAFSNVLR-GTGGAL 288 Query: 464 NFAFKDKYK 490 F D+ K Sbjct: 289 VLVFYDEVK 297 Score = 32.7 bits (71), Expect = 0.010 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = +3 Query: 198 MSNLADPVAFAKDFLAGGI 254 M+ ADP FAKDFLAGGI Sbjct: 1 MTKKADPYGFAKDFLAGGI 19 >AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocase protein. Length = 301 Score = 153 bits (371), Expect = 4e-39 Identities = 73/87 (83%), Positives = 79/87 (90%) Frame = +2 Query: 257 AAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANV 436 AAVSKTAVAPIERVKLLLQVQ SKQIA D++YKGIVD FVRIPKEQG+ +FWRGN ANV Sbjct: 21 AAVSKTAVAPIERVKLLLQVQAASKQIAVDKQYKGIVDCFVRIPKEQGIGAFWRGNLANV 80 Query: 437 IRYFPTQALNFAFKDKYKQVFLGGLTR 517 IRYFPTQALNFAFKD YKQVFLGG+ + Sbjct: 81 IRYFPTQALNFAFKDVYKQVFLGGVDK 107 Score = 36.7 bits (81), Expect = 6e-04 Identities = 22/69 (31%), Positives = 40/69 (57%) Frame = +2 Query: 284 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQAL 463 P + V+ + +Q S + ++ YK +D +V+I K++G +F++G F+NV+R AL Sbjct: 232 PFDTVRRRMMMQ--SGRAKSEVMYKNTLDCWVKIGKQEGSGAFFKGAFSNVLR-GTGGAL 288 Query: 464 NFAFKDKYK 490 F D+ K Sbjct: 289 VLVFYDEVK 297 Score = 35.5 bits (78), Expect = 0.001 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 525 FWRYFXXXXXXXXXXXXTSLCFV*PLDFGST 617 FWRYF TSLCFV PLDF T Sbjct: 111 FWRYFLGNLGSGGAAGATSLCFVYPLDFART 141 Score = 32.7 bits (71), Expect = 0.010 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = +3 Query: 198 MSNLADPVAFAKDFLAGGI 254 M+ ADP FAKDFLAGGI Sbjct: 1 MTKKADPYGFAKDFLAGGI 19 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 33.5 bits (73), Expect = 0.006 Identities = 27/68 (39%), Positives = 35/68 (51%) Frame = +1 Query: 178 RSHNRTKCRTSPIRSRSLRTSWLAVSRRRLQDRRSTHRACQAAAPSTARQQADRRRPALQ 357 +S +R+K RTS RSRS RT A R + R T + AA + A + RRR + Sbjct: 444 QSRSRSKTRTS--RSRS-RTPLPARGHVRARLTRRTIPPTRVAAAAAAPEGRRRRRAIAR 500 Query: 358 GYRRRLRP 381 RRR RP Sbjct: 501 ARRRRCRP 508 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 22.6 bits (46), Expect(2) = 1.4 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -3 Query: 371 RRRYPCNAGRR 339 RRRYP NAG + Sbjct: 346 RRRYPTNAGHK 356 Score = 21.0 bits (42), Expect(2) = 1.4 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = -3 Query: 428 RSYHARMKGDPAPWGCGRRRRRYP 357 R R++ P P R RRR P Sbjct: 315 REAAGRLRTGPVPGAAERHRRRRP 338 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 24.6 bits (51), Expect = 2.6 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +1 Query: 247 AVSRRRLQDRRSTHRACQAAAPSTA-RQQADRRRPALQGYRRRLR 378 A + RR ++RR+ A+P TA R+ A R R A RRR R Sbjct: 1117 AATARRREERRAGLPPTPPASPRTAQRRAALRERQARFRERRRNR 1161 >AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant receptor Or2 protein. Length = 378 Score = 24.2 bits (50), Expect = 3.4 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +1 Query: 229 LRTSWLAVSRRRLQDRRSTHRACQAAAPSTARQQADRRRPALQGYRRRLR 378 LRTS+L ++RR+ + AA ++ D RP L+ Y RR R Sbjct: 73 LRTSFLVINRRKFETFFE-----GVAAEYALLEKNDDIRPVLERYTRRGR 117 >DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. Length = 553 Score = 23.4 bits (48), Expect = 6.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 30 EFQKRHTPTLCAPVITKLLQ 89 EFQ+R TP + +++K+ Q Sbjct: 350 EFQRRLTPAMIGELVSKMTQ 369 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 626,779 Number of Sequences: 2352 Number of extensions: 12386 Number of successful extensions: 30 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60553008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -