BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30357 (652 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8GPE9 Cluster: Eps4K; n=2; Streptococcus|Rep: Eps4K - ... 34 2.6 UniRef50_Q0CBQ2 Cluster: Predicted protein; n=1; Aspergillus ter... 33 7.8 UniRef50_P16495 Cluster: Nucleocapsid protein; n=23; Orthobunyav... 33 7.8 >UniRef50_Q8GPE9 Cluster: Eps4K; n=2; Streptococcus|Rep: Eps4K - Streptococcus thermophilus Length = 384 Score = 34.3 bits (75), Expect = 2.6 Identities = 18/41 (43%), Positives = 25/41 (60%) Frame = -2 Query: 123 LQADGVXSLENIWGKRRRFWKANAAVNPVKRFIVKSLGLSA 1 L AD +L I GK RF++ N +NP+ RF+ K L +SA Sbjct: 227 LYADKYVTLRKIKGKLSRFFEKNFGINPL-RFVTKKLKVSA 266 >UniRef50_Q0CBQ2 Cluster: Predicted protein; n=1; Aspergillus terreus NIH2624|Rep: Predicted protein - Aspergillus terreus (strain NIH 2624) Length = 710 Score = 32.7 bits (71), Expect = 7.8 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +1 Query: 250 LPWNS*LKPVRLRTRKANVWRRFCREITPS*TLSGLCSPIR 372 +PWN V R A++W + R IT S T++ LC PI+ Sbjct: 399 IPWNH--NRVATRRDLASIWATYHRHITISNTINFLCGPIK 437 >UniRef50_P16495 Cluster: Nucleocapsid protein; n=23; Orthobunyavirus|Rep: Nucleocapsid protein - Bunyamwera virus Length = 233 Score = 32.7 bits (71), Expect = 7.8 Identities = 17/46 (36%), Positives = 25/46 (54%) Frame = +1 Query: 115 GLEWDNAVELKCRLYLSAVSGAEHFLKIFGVYPLVCALKKYQMKKL 252 G+ W++ E+ YLS G+E FL F YPL + K Q K++ Sbjct: 131 GITWNDGEEV----YLSFFPGSEMFLGTFRFYPLAIGIYKVQRKEM 172 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 637,714,798 Number of Sequences: 1657284 Number of extensions: 12991286 Number of successful extensions: 29283 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 28506 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29254 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 48760335122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -