BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30357 (652 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 22 5.0 AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esteras... 22 5.0 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 21 6.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 8.8 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 21.8 bits (44), Expect = 5.0 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +3 Query: 90 YFQAXSRHRPGVGQRGRIKMPLIL 161 YF + +RPG+G+ + +P+ L Sbjct: 27 YFSNWAIYRPGIGRYAQEDLPVDL 50 >AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.8 bits (44), Expect = 5.0 Identities = 7/25 (28%), Positives = 15/25 (60%) Frame = +3 Query: 345 IVWTMFPDTGSNNLSAILMNAPAEL 419 I W P ++NL+ + + AP+++ Sbjct: 490 IEWPQVPKNATDNLTYLRIGAPSDV 514 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 21.4 bits (43), Expect = 6.7 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +3 Query: 198 IRGLPSRLRFKEIPNEKTTLELVIKAGKIKNEKGER 305 I L L+F+ I + T EL++ + K E+ E+ Sbjct: 365 ISRLVETLKFQSITSAVVTYELIVIQFRKKMERDEK 400 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 8.8 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = +3 Query: 489 FLYDNTHLHSYFICN 533 F+ D+T+ Y++CN Sbjct: 2242 FVADDTNCAQYYLCN 2256 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,882 Number of Sequences: 336 Number of extensions: 3216 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -