BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30356 (479 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 24 0.63 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 24 0.63 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 1.9 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 1.9 AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 22 3.4 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 21 4.5 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 5.9 DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 21 5.9 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 21 5.9 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 7.8 AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcrip... 21 7.8 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 24.2 bits (50), Expect = 0.63 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +1 Query: 124 QADHPRQVQXHHQVAGFQPTGRQG 195 Q HP+ Q HHQ G+QG Sbjct: 172 QEQHPQHHQPHHQQQHMMYGGQQG 195 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 24.2 bits (50), Expect = 0.63 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +1 Query: 124 QADHPRQVQXHHQVAGFQPTGRQG 195 Q HP+ Q HHQ G+QG Sbjct: 174 QEQHPQHHQPHHQQQHMMYGGQQG 197 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 22.6 bits (46), Expect = 1.9 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -1 Query: 203 HTPPCRPVGWNP 168 H PP PVG NP Sbjct: 743 HQPPRNPVGTNP 754 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 22.6 bits (46), Expect = 1.9 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -1 Query: 203 HTPPCRPVGWNP 168 H PP PVG NP Sbjct: 635 HQPPRNPVGTNP 646 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 21.8 bits (44), Expect = 3.4 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +2 Query: 68 SMKSTMEDEKLKEKISDSD 124 S+ S EDE+++ ++SD D Sbjct: 18 SLLSKKEDEEVEHRLSDRD 36 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 21.4 bits (43), Expect = 4.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 311 PEPEVPPPGLEALAPPS 361 P P+VPP L + PP+ Sbjct: 176 PLPQVPPLPLPPIFPPT 192 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.0 bits (42), Expect = 5.9 Identities = 8/12 (66%), Positives = 11/12 (91%) Frame = -2 Query: 121 RVRDLFLELLIL 86 RV+DLFLE ++L Sbjct: 581 RVKDLFLEAVLL 592 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 21.0 bits (42), Expect = 5.9 Identities = 12/44 (27%), Positives = 20/44 (45%) Frame = +2 Query: 239 PIITKSTRVPEESPEVCRASRAEHPEPEVPPPGLEALAPPSRRS 370 P+ + RVP+ +S + PEP P + + SR+S Sbjct: 268 PLDLYNFRVPQHQVLQSPSSTSSSPEPRSPESLFKPVTVISRQS 311 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 21.0 bits (42), Expect = 5.9 Identities = 11/40 (27%), Positives = 16/40 (40%) Frame = +2 Query: 311 PEPEVPPPGLEALAPPSRRSIKPTFHTTRKPTCNNHLVTS 430 P+ E+P P + + S+ PT T P L S Sbjct: 73 PKREIPSPKRSSPILAEKVSVSPTTPPTPSPPPEERLTPS 112 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.6 bits (41), Expect = 7.8 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -2 Query: 268 RHPGTLRYYRIAN 230 + PG L YY I N Sbjct: 899 KQPGMLAYYEICN 911 >AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcription factor TcDfd1 protein. Length = 126 Score = 20.6 bits (41), Expect = 7.8 Identities = 8/23 (34%), Positives = 10/23 (43%) Frame = +2 Query: 353 PPSRRSIKPTFHTTRKPTCNNHL 421 PP I+P +P CN L Sbjct: 95 PPIHHQIRPPILHDTQPMCNPQL 117 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 96,120 Number of Sequences: 336 Number of extensions: 1959 Number of successful extensions: 11 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11247091 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -