BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30356 (479 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 4.1 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 22 9.5 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.4 bits (48), Expect = 4.1 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +2 Query: 290 RASRAEHPEPEVPPPGLEALAPPSRRSIK 376 R H +VPPPG+E P + I+ Sbjct: 1740 RMEEGAHLSFKVPPPGIEFTLPSPKIGIE 1768 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 22.2 bits (45), Expect = 9.5 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = -2 Query: 421 KVVVTGRFTCGVECWFNRPPRWWGQRLQPRGRHLRLRVLRPGSPAYLRG 275 +VVV G F E W +R G+ L + L L ++ G+ A G Sbjct: 174 QVVVAGDFNAWHEEWGSRRSNERGEVLLEASQQLGLLLMNRGNVATFVG 222 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 426,849 Number of Sequences: 2352 Number of extensions: 8167 Number of successful extensions: 23 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 41863041 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -