SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= heS30351
         (488 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q1HPY3 Cluster: Secreted protein acidic and rich in cys...    35   0.84 
UniRef50_A6M2G9 Cluster: Polysaccharide biosynthesis protein; n=...    32   7.9  

>UniRef50_Q1HPY3 Cluster: Secreted protein acidic and rich in
           cysteine; n=4; Neoptera|Rep: Secreted protein acidic and
           rich in cysteine - Bombyx mori (Silk moth)
          Length = 317

 Score = 35.1 bits (77), Expect = 0.84
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +2

Query: 2   RCDDFNENAEHYL 40
           RCDDFNENAEHYL
Sbjct: 305 RCDDFNENAEHYL 317


>UniRef50_A6M2G9 Cluster: Polysaccharide biosynthesis protein; n=1;
           Clostridium beijerinckii NCIMB 8052|Rep: Polysaccharide
           biosynthesis protein - Clostridium beijerinckii NCIMB
           8052
          Length = 500

 Score = 31.9 bits (69), Expect = 7.9
 Identities = 15/45 (33%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = -3

Query: 420 FISMSN-MKKKFFNLFVSCEYXND*IFFLTCAVINFHI*FSLYYI 289
           F S++N +    + +FV+  Y N+  +F TC V+ F++ F+L+Y+
Sbjct: 102 FASVTNILASAAYMIFVAIFYKNE-PYFYTCIVMGFNLVFNLFYV 145


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 364,010,982
Number of Sequences: 1657284
Number of extensions: 5800797
Number of successful extensions: 8030
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 7847
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8028
length of database: 575,637,011
effective HSP length: 95
effective length of database: 418,195,031
effective search space used: 28019067077
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -