BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30351 (488 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16226| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_16225| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 >SB_16226| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 28.7 bits (61), Expect = 2.7 Identities = 12/46 (26%), Positives = 27/46 (58%) Frame = -3 Query: 420 FISMSNMKKKFFNLFVSCEYXND*IFFLTCAVINFHI*FSLYYILF 283 FI+ ++ K FN+F+SC D I++ +V+ F + + ++++ Sbjct: 165 FINWTDYGKPHFNIFISCANF-DPIYYTVLSVVLFFLPLFIVFVMY 209 >SB_16225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 28.7 bits (61), Expect = 2.7 Identities = 12/46 (26%), Positives = 27/46 (58%) Frame = -3 Query: 420 FISMSNMKKKFFNLFVSCEYXND*IFFLTCAVINFHI*FSLYYILF 283 FI+ ++ K FN+F+SC D I++ +V+ F + + ++++ Sbjct: 165 FINWTDYGKPHFNIFISCANF-DPIYYTVVSVVLFFLPLYIVFVMY 209 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,065,968 Number of Sequences: 59808 Number of extensions: 164753 Number of successful extensions: 158 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 154 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 158 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1038380485 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -