BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30351 (488 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68335-3|CAA92730.2| 540|Caenorhabditis elegans Hypothetical pr... 28 3.2 AL132862-33|CAB70222.3| 308|Caenorhabditis elegans Hypothetical... 27 9.7 >Z68335-3|CAA92730.2| 540|Caenorhabditis elegans Hypothetical protein C29F4.2 protein. Length = 540 Score = 28.3 bits (60), Expect = 3.2 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = -1 Query: 314 TFNFHYTIFYSKDKVIIKSLYK 249 T+N+HY + S+ KVI+K ++K Sbjct: 2 TYNYHYDLATSQRKVILKLIFK 23 >AL132862-33|CAB70222.3| 308|Caenorhabditis elegans Hypothetical protein Y73F8A.3 protein. Length = 308 Score = 26.6 bits (56), Expect = 9.7 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -1 Query: 377 LFHVSXLMIKFFF*LVL*SIFTFNFHYTIFYS 282 + H S L K+F+ +L S TF F+Y +Y+ Sbjct: 116 VIHNSSLTKKYFYIYMLGSFITFAFYYFYWYA 147 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,955,682 Number of Sequences: 27780 Number of extensions: 153330 Number of successful extensions: 252 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 251 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 252 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 914086948 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -