BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30350 (555 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 26 0.95 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 25 2.2 DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. 23 6.7 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 6.7 AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CY... 23 8.9 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 23 8.9 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 23 8.9 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 23 8.9 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 25.8 bits (54), Expect = 0.95 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -3 Query: 523 YPYLDVVDCW 494 YP+LD VDCW Sbjct: 498 YPHLDSVDCW 507 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 24.6 bits (51), Expect = 2.2 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -2 Query: 251 MFSTCEQTVLTAASSFLDPN 192 M S CE+T+ SSF DP+ Sbjct: 327 MISACEKTMQRMTSSFPDPH 346 >DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. Length = 410 Score = 23.0 bits (47), Expect = 6.7 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +1 Query: 346 LRYVTSWVRNTSEG 387 +RY+ SWV N + G Sbjct: 84 VRYINSWVHNQTHG 97 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 6.7 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -2 Query: 287 HLVLEAFSYSFIMFSTCEQTVLTAAS 210 H VL +FS+ F F+ C T S Sbjct: 62 HFVLFSFSFPFFSFAPCTLASATEIS 87 >AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CYP12F1 protein. Length = 522 Score = 22.6 bits (46), Expect = 8.9 Identities = 15/59 (25%), Positives = 26/59 (44%) Frame = -3 Query: 481 ELETSSKELPSMISSSFCFGELTTVTPGAIFTLLMYFSPKKLRISIIELPSVVTQLMGK 305 E T +K + S++ F P + L YF L++ + EL ++ +MGK Sbjct: 226 EQTTGAKAIISLVQKIFDLMYRLEFEPE--YVLWKYFQTPSLKLLMQELDNLTNLVMGK 282 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 22.6 bits (46), Expect = 8.9 Identities = 11/43 (25%), Positives = 19/43 (44%) Frame = -3 Query: 268 LVTPLSCSLHVNRLSSRRQAPFWIRTISQPSGDEGLPCECQQP 140 LVT + + R+++ F+ R S P G + P + P Sbjct: 339 LVTDVLSEFYNRRIAANANGLFYDRAGSVPGGSDSAPPKSNPP 381 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 22.6 bits (46), Expect = 8.9 Identities = 11/43 (25%), Positives = 19/43 (44%) Frame = -3 Query: 268 LVTPLSCSLHVNRLSSRRQAPFWIRTISQPSGDEGLPCECQQP 140 LVT + + R+++ F+ R S P G + P + P Sbjct: 339 LVTDVLSEFYNRRIAANANGLFYDRAGSVPGGSDSAPPKSNPP 381 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 22.6 bits (46), Expect = 8.9 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -2 Query: 254 IMFSTCEQTVLTAASSFLDPN 192 IM +TC++T+ +S DP+ Sbjct: 263 IMLATCDKTMQRVTTSHSDPH 283 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 594,827 Number of Sequences: 2352 Number of extensions: 12778 Number of successful extensions: 25 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 51722361 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -