BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30346 (447 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0887 + 6803937-6804030,6804101-6804204 29 1.3 04_03_0368 + 15004949-15005659,15005789-15005848 28 3.0 03_06_0518 - 34474776-34474865,34475168-34475437,34475536-344758... 28 3.0 12_01_1103 + 11624736-11624997,11625308-11625400,11625559-11625593 27 5.2 09_04_0480 + 17958726-17958926,17959294-17959382,17960176-179602... 27 6.9 02_02_0363 + 9446055-9446524,9446658-9446771,9446856-9447281,944... 27 9.1 01_01_1053 - 8305111-8305476 27 9.1 >06_01_0887 + 6803937-6804030,6804101-6804204 Length = 65 Score = 29.5 bits (63), Expect = 1.3 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = +1 Query: 244 KTLARSRR*RAYCPDSGARLKHFSPPRXH 330 K LA S R + +C GAR+ FSPPR H Sbjct: 33 KELASSLRNKKFC--KGARVHTFSPPRHH 59 >04_03_0368 + 15004949-15005659,15005789-15005848 Length = 256 Score = 28.3 bits (60), Expect = 3.0 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -1 Query: 345 PKNQXVXSWGRKVLEPGSRIWTVGP 271 P+ + + + GR++ PGSRIW P Sbjct: 144 PRRRRLLTAGRQIWPPGSRIWPPAP 168 >03_06_0518 - 34474776-34474865,34475168-34475437,34475536-34475831, 34475924-34476013,34476172-34476337,34476399-34476679, 34476881-34477217 Length = 509 Score = 28.3 bits (60), Expect = 3.0 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +3 Query: 240 RKDPSPQPTVKGLLSRF-GSQAQALFAPKKXRFGSSVA-IHKLRE 368 R+D P+PT K L RF G + P+ R +SVA + K+ E Sbjct: 379 RRDLDPRPTTKWALQRFRGGEVVVAMDPRIRRSPASVATVEKVME 423 >12_01_1103 + 11624736-11624997,11625308-11625400,11625559-11625593 Length = 129 Score = 27.5 bits (58), Expect = 5.2 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +3 Query: 114 VAKIKNNF*TIEFENCF*IRHRSG 185 +A+I+NNF + ENC I H+SG Sbjct: 75 LAEIRNNFDILSRENCRGIGHQSG 98 >09_04_0480 + 17958726-17958926,17959294-17959382,17960176-17960242, 17960329-17960444,17960978-17961044,17961158-17961206, 17961630-17961715,17961825-17962078,17962158-17962213, 17962683-17962768,17963047-17963139,17963790-17964219, 17964338-17964861,17964962-17965190,17965271-17965566 Length = 880 Score = 27.1 bits (57), Expect = 6.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +2 Query: 287 IREPGSSTFRPQEXTXWFFGGHPQTPR 367 +R PG ST++ ++ W FG H PR Sbjct: 379 VRRPGLSTWKVRDRGSW-FGTHEDVPR 404 >02_02_0363 + 9446055-9446524,9446658-9446771,9446856-9447281, 9447812-9447893,9447964-9448020,9448633-9448881, 9448978-9449109,9449163-9449291 Length = 552 Score = 26.6 bits (56), Expect = 9.1 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = +3 Query: 174 HRSGFNGSEVRNLPEFPAXQAARKDPSPQPTVKGLLSRFGSQAQA 308 HR+ G+ LP A AA P P P ++ G A+A Sbjct: 237 HRNSLAGTTRNKLPSSSAASAASAQPQPPPPSVVVVGAGGGGAEA 281 >01_01_1053 - 8305111-8305476 Length = 121 Score = 26.6 bits (56), Expect = 9.1 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +3 Query: 195 SEVRNLPEFPAXQAARKDPSPQPTVKGLLSRFGSQAQA 308 +E RN+ A A KD QPT RFGS A Sbjct: 22 AEARNIKAAAAAAAESKDTVVQPTTFPPFDRFGSAVPA 59 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,392,321 Number of Sequences: 37544 Number of extensions: 258610 Number of successful extensions: 656 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 650 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 656 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 859680288 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -