BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30346 (447 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15095| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_37360| Best HMM Match : ETS_PEA3_N (HMM E-Value=0.65) 27 9.3 SB_28593| Best HMM Match : CUB (HMM E-Value=1.3e-14) 27 9.3 >SB_15095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 27.1 bits (57), Expect = 7.1 Identities = 15/57 (26%), Positives = 24/57 (42%) Frame = -2 Query: 251 RVFSGGLXCWKLRQVTNLASIEPTPVTNSKTILEFDSLEIVLNLRDSFAANVLSLLQ 81 ++ +G + W + ++ KTIL FDS E+ L L V+ LQ Sbjct: 238 KLMAGQIDLWATGDPAGRYLAKQDGISGLKTILRFDSAELYLALNKEVPDEVVQKLQ 294 >SB_37360| Best HMM Match : ETS_PEA3_N (HMM E-Value=0.65) Length = 861 Score = 26.6 bits (56), Expect = 9.3 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 310 FSPPRXHXLVLRWPSTNSARP 372 FSPPR H + R+ S NS P Sbjct: 169 FSPPRNHGSLSRYTSKNSLSP 189 >SB_28593| Best HMM Match : CUB (HMM E-Value=1.3e-14) Length = 327 Score = 26.6 bits (56), Expect = 9.3 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 245 RP*PAADGEGPTVQIREPGSSTFRPQEXTXWFFGGHPQTPRDQV 376 RP P A +G + + PGS +PQ GG+P P+ Q+ Sbjct: 267 RPPPVAVQQGQPLVVPPPGSYPTQPQTGYP-AQGGYPMQPQGQM 309 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,998,216 Number of Sequences: 59808 Number of extensions: 285869 Number of successful extensions: 601 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 573 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 601 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 883875528 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -